StarFunc result for job id Q6P589

User Input

>input (184 residues)
MESFSSKSLALQAEKKLLSKMAGRSVAHLFIDETSSEVLDELYRVSKEYTHSRPQAQRVI
KDLIKVAIKVAVLHRNGSFGPSELALATRFRQKLRQGAMTALSFGEVDFTFEAAVLAGLL
TECRDVLLELVEHHLTPKSHGRIRHVFDHFSDPGLLTALYGPDFTQHLGKICDGLRKLLD
EGKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P589	1.000	1.000	7.005E-24	184	1.000	1.000	Q6P589.pdb.gz	TP8L2_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 2 OS=Homo sapiens OX=9606 GN=TNFAIP8L2 PE=1 SV=1
2	AFDB:Q8K288	0.860	0.851	5.048E-16	186	0.571	0.565	Q8K288.pdb.gz	TP8L1_MOUSE Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Mus musculus OX=10090 GN=Tnfaip8l1 PE=1 SV=1
3	AFDB:Q8WVP5	0.861	0.852	9.436E-16	186	0.576	0.570	Q8WVP5.pdb.gz	TP8L1_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Homo sapiens OX=9606 GN=TNFAIP8L1 PE=1 SV=2
4	AFDB:Q5GJ75	0.862	0.548	1.144E-15	292	0.549	0.346	Q5GJ75.pdb.gz	TP8L3_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP8L3 PE=1 SV=1
5	AFDB:D6RCM8	0.866	0.798	1.681E-15	200	0.538	0.495	D6RCM8.pdb.gz	D6RCM8_HUMAN TNF alpha induced protein 8 OS=Homo sapiens OX=9606 GN=TNFAIP8 PE=1 SV=1
6	PDB:5jxdA	0.868	0.858	3.626E-15	186	0.565	0.559	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
7	AFDB:Q7KVH9	0.850	0.833	5.958E-13	188	0.391	0.383	Q7KVH9.pdb.gz	TFP8L_DROME Protein salivary glands marred OS=Drosophila melanogaster OX=7227 GN=sigmar PE=1 SV=2
8	AFDB:Q55BQ2	0.694	0.425	2.547E-4	310	0.190	0.113	Q55BQ2.pdb.gz	Q55BQ2_DICDI PH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0271086 PE=1 SV=1
9	PDB:6xz6A	0.190	0.167	4.008E-1	213	0.120	0.103	6xz6A.pdb.gz
10	AFDB:Q13796	0.301	0.053	4.013E-1	1616	0.190	0.022	Q13796.pdb.gz	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
11	AFDB:D4ABK1	0.204	0.193	4.418E-1	199	0.130	0.121	D4ABK1.pdb.gz	D4ABK1_RAT Synaptogyrin 3 OS=Rattus norvegicus OX=10116 GN=Syngr3 PE=1 SV=2
12	PDB:7nd2A	0.193	0.118	6.181E-1	330	0.120	0.067	7nd2A.pdb.gz
13	AFDB:Q94JG1	0.275	0.135	6.813E-1	516	0.136	0.048	Q94JG1.pdb.gz	NRT23_ORYSJ High-affinity nitrate transporter 2.3 OS=Oryza sativa subsp. japonica OX=39947 GN=NRT2.3 PE=1 SV=1
14	PDB:7be8A	0.254	0.223	8.250E-1	219	0.092	0.078	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.
15	PDB:1cqxA	0.204	0.109	8.656E-1	403	0.065	0.030	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
16	PDB:1bz1A	0.248	0.303	1.155	142	0.141	0.183	1bz1A.pdb.gz	Structural and functional properties of human hemoglobins reassembled after synthesis in Escherichia coli.
17	PDB:4kbrB	0.227	0.209	1.272	207	0.141	0.126	4kbrB.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
18	PDB:2dc3A	0.244	0.259	1.401	172	0.147	0.157	2dc3A.pdb.gz	High-resolution structure of human cytoglobin: identification of extra N- and C-termini and a new dimerization mode.
19	PDB:3iqcA	0.268	0.353	1.401	119	0.076	0.118	3iqcA.pdb.gz
20	PDB:7b5pA	0.210	0.057	1.470	985	0.120	0.022	7b5pA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6P589	4.19e-133	372	184	1.000	1.000	TP8L2_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 2 OS=Homo sapiens OX=9606 GN=TNFAIP8L2 PE=1 SV=1
2	Q9D8Y7	1.97e-125	352	184	0.940	0.940	TP8L2_MOUSE Tumor necrosis factor alpha-induced protein 8-like protein 2 OS=Mus musculus OX=10090 GN=Tnfaip8l2 PE=1 SV=1
3	Q921Z5	1.23e-74	224	198	0.565	0.525	TFIP8_MOUSE Tumor necrosis factor alpha-induced protein 8 OS=Mus musculus OX=10090 GN=Tnfaip8 PE=1 SV=1
4	O95379	2.03e-73	221	198	0.538	0.500	TFIP8_HUMAN Tumor necrosis factor alpha-induced protein 8 OS=Homo sapiens OX=9606 GN=TNFAIP8 PE=1 SV=1
5	D6RCM8	4.50e-73	220	200	0.538	0.495	D6RCM8_HUMAN TNF alpha induced protein 8 OS=Homo sapiens OX=9606 GN=TNFAIP8 PE=1 SV=1
6	A0A1B0GTK8	3.44e-72	218	204	0.549	0.495	A0A1B0GTK8_HUMAN TNF alpha induced protein 8 like 3 OS=Homo sapiens OX=9606 GN=TNFAIP8L3 PE=1 SV=1
7	Q5GJ75	6.62e-70	215	292	0.543	0.342	TP8L3_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Homo sapiens OX=9606 GN=TNFAIP8L3 PE=1 SV=1
8	Q8K288	1.17e-69	211	186	0.571	0.565	TP8L1_MOUSE Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Mus musculus OX=10090 GN=Tnfaip8l1 PE=1 SV=1
9	Q8WVP5	1.55e-68	208	186	0.576	0.570	TP8L1_HUMAN Tumor necrosis factor alpha-induced protein 8-like protein 1 OS=Homo sapiens OX=9606 GN=TNFAIP8L1 PE=1 SV=2
10	Q3TBL6	3.48e-68	208	204	0.511	0.461	TP8L3_MOUSE Tumor necrosis factor alpha-induced protein 8-like protein 3 OS=Mus musculus OX=10090 GN=Tnfaip8l3 PE=1 SV=1
11	Q7KVH9	1.04e-34	122	188	0.391	0.383	TFP8L_DROME Protein salivary glands marred OS=Drosophila melanogaster OX=7227 GN=sigmar PE=1 SV=2
12	Q7KN85	0.39	33.5	1112	0.120	0.020	Q7KN85_DROME ATP-citrate synthase OS=Drosophila melanogaster OX=7227 GN=ATPCL PE=1 SV=1
13	Q38E30	3.8	30.0	250	0.103	0.076	Q38E30_TRYB2 Proteasome subunit alpha type OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1250 PE=3 SV=1
14	O70608	4.4	30.4	1505	0.147	0.018	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
15	Q3EDH0	6.7	29.6	695	0.082	0.022	SCL31_ARATH Scarecrow-like protein 31 OS=Arabidopsis thaliana OX=3702 GN=SCL31 PE=2 SV=3
16	F4IJS7	6.9	29.6	613	0.065	0.020	F4IJS7_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=PPR_66 PE=1 SV=1
17	O74356	7.3	29.6	585	0.087	0.027	YH16_SCHPO Putative ATP-dependent RNA helicase C25D12.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC25D12.06 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05527 DUF758	4.2e-72	253.4	Domain of unknown function (DUF758)
2	PF02391 MoaE	93	14.7	MoaE protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357906

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351273	0.967	Caspase-8
2	9606.ENSP00000313034	0.730	F-box/WD repeat-containing protein 5
3	9606.ENSP00000246115	0.677	Sphingosine 1-phosphate receptor 4
4	9606.ENSP00000268389	0.663	Immunoglobulin superfamily member 6
5	9606.ENSP00000370222	0.643	Proteasome maturation protein
6	9606.ENSP00000375629	0.631	Leukocyte immunoglobulin-like receptor subfamily B member 2
7	9606.ENSP00000354932	0.588	Toll-like receptor 1
8	9606.ENSP00000262629	0.584	TYRO protein tyrosine kinase-binding protein
9	9606.ENSP00000444986	0.574	Tyrosine-protein kinase HCK
10	9606.ENSP00000234313	0.563	Pleckstrin
11	9606.ENSP00000246551	0.560	Hematopoietic cell signal transducer
12	9606.ENSP00000380948	0.555	Integrin beta-2
13	9606.ENSP00000363117	0.552	Tyrosine-protein kinase Fgr
14	9606.ENSP00000356992	0.547	Rho GTPase-activating protein 30
15	9606.ENSP00000300589	0.543	Nucleotide-binding oligomerization domain-containing protein 2
16	9606.ENSP00000479870	0.541	Arachidonate 5-lipoxygenase-activating protein
17	9606.ENSP00000357123	0.537	Myeloid cell nuclear differentiation antigen
18	9606.ENSP00000302046	0.535	Ribonuclease K6
19	9606.ENSP00000348461	0.506	Ras-related C3 botulinum toxin substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048583	0.998	regulation of response to stimulus
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.995	negative regulation of biological process
GO:0048585	0.992	negative regulation of response to stimulus
GO:0009987	0.986	cellular process
GO:0048523	0.984	negative regulation of cellular process
GO:0002683	0.894	negative regulation of immune system process
GO:0050865	0.893	regulation of cell activation
GO:0030155	0.880	regulation of cell adhesion
GO:0032501	0.868	multicellular organismal process
GO:0002694	0.862	regulation of leukocyte activation
GO:0022407	0.858	regulation of cell-cell adhesion
GO:0051249	0.854	regulation of lymphocyte activation
GO:0051241	0.840	negative regulation of multicellular organismal process
GO:0001775	0.828	cell activation
GO:0046649	0.815	lymphocyte activation
GO:0002695	0.808	negative regulation of leukocyte activation
GO:1903037	0.802	regulation of leukocyte cell-cell adhesion
GO:0032101	0.783	regulation of response to external stimulus
GO:0007162	0.763	negative regulation of cell adhesion
GO:0080134	0.760	regulation of response to stress
GO:0050727	0.731	regulation of inflammatory response
GO:0022408	0.710	negative regulation of cell-cell adhesion
GO:0051250	0.699	negative regulation of lymphocyte activation
GO:0050863	0.695	regulation of T cell activation
GO:1903038	0.644	negative regulation of leukocyte cell-cell adhesion
GO:0050896	0.640	response to stimulus
GO:0042110	0.545	T cell activation
GO:0050868	0.491	negative regulation of T cell activation
GO:0048518	0.438	positive regulation of biological process
GO:0009966	0.419	regulation of signal transduction
GO:0048522	0.372	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0016020	0.412	membrane
GO:0071944	0.408	cell periphery
GO:0005886	0.398	plasma membrane
GO:0070013	0.376	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]