StarFunc result for job id Q6P5Q4

User Input

>input (547 residues)
MSTFGYRRGLSKYESIDEDELLASLSAEELKELERELEDIEPDRNLPVGLRQKSLTEKTP
TGTFSREALMAYWEKESQKLLEKERLGECGKVAEDKEESEEELIFTESNSEVSEEVYTEE
EEEESQEEEEEEDSDEEERTIETAKGINGTVNYDSVNSDNSKPKIFKSQIENINLTNGSN
GRNTESPAAIHPCGNPTVIEDALDKIKSNDPDTTEVNLNNIENITTQTLTRFAEALKDNT
VVKTFSLANTHADDSAAMAIAEMLKVNEHITNVNVESNFITGKGILAIMRALQHNTVLTE
LRFHNQRHIMGSQVEMEIVKLLKENTTLLRLGYHFELPGPRMSMTSILTRNMDKQRQKRL
QEQKQQEGYDGGPNLRTKVWQRGTPSSSPYVSPRHSPWSSPKLPKKVQTVRSRPLSPVAT
PPPPPPPPPPPPPSSQRLPPPPPPPPPPLPEKKLITRNIAEVIKQQESAQRALQNGQKKK
KGKKVKKQPNSILKEIKNSLRSVQEKKMEDSSRPSTPQRSAHENLMEAIRGSSIKQLKRV
EVPEALR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P5Q4	1.000	1.000	1.372E-80	547	1.000	1.000	Q6P5Q4.pdb.gz	LMOD2_HUMAN Leiomodin-2 OS=Homo sapiens OX=9606 GN=LMOD2 PE=1 SV=2
2	AFDB:Q3UHZ5	0.418	0.416	2.508E-69	550	0.899	0.895	Q3UHZ5.pdb.gz	LMOD2_MOUSE Leiomodin-2 OS=Mus musculus OX=10090 GN=Lmod2 PE=1 SV=1
3	AFDB:E1BTG2	0.353	0.350	5.142E-58	552	0.722	0.716	E1BTG2.pdb.gz	LMOD2_CHICK Leiomodin-2 OS=Gallus gallus OX=9031 GN=LMOD2 PE=1 SV=2
4	AFDB:Q0VAK6	0.348	0.340	6.411E-35	560	0.371	0.362	Q0VAK6.pdb.gz	LMOD3_HUMAN Leiomodin-3 OS=Homo sapiens OX=9606 GN=LMOD3 PE=1 SV=1
5	AFDB:A0A0G2K0D3	0.327	0.301	1.602E-34	595	0.404	0.371	A0A0G2K0D3.pdb.gz	LMOD1_RAT Leiomodin-1 OS=Rattus norvegicus OX=10116 GN=Lmod1 PE=1 SV=1
6	AFDB:E9QA62	0.346	0.332	1.675E-33	571	0.369	0.354	E9QA62.pdb.gz	LMOD3_MOUSE Leiomodin-3 OS=Mus musculus OX=10090 GN=Lmod3 PE=1 SV=1
7	AFDB:P29536	0.323	0.295	1.675E-33	600	0.413	0.377	P29536.pdb.gz	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
8	PDB:4rwtD	0.311	0.603	1.506E-32	280	0.495	0.968	4rwtD.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
9	AFDB:E7F7X0	0.349	0.289	4.907E-32	670	0.375	0.306	E7F7X0.pdb.gz	LMOD3_DANRE Leiomodin-3 OS=Danio rerio OX=7955 GN=lmod3 PE=1 SV=1
10	PDB:5wfnC	0.309	0.871	2.306E-25	193	0.311	0.881	5wfnC.pdb.gz	Mechanisms of leiomodin 2-mediated regulation of actin filament in muscle cells.
11	AFDB:Q9JHJ0	0.310	0.480	4.690E-24	352	0.241	0.375	Q9JHJ0.pdb.gz	TMOD3_MOUSE Tropomodulin-3 OS=Mus musculus OX=10090 GN=Tmod3 PE=1 SV=1
12	AFDB:F1NY71	0.313	0.473	6.244E-24	359	0.265	0.404	F1NY71.pdb.gz
13	PDB:1a4yA	0.200	0.233	2.785E-4	460	0.042	0.050	1a4yA.pdb.gz
14	PDB:7pzcA	0.232	0.130	3.307E-4	1010	0.051	0.028	7pzcA.pdb.gz	Structure of the NLRP3 decamer bound to the cytokine release inhibitor CRID3.
15	PDB:7lfhA	0.196	0.134	6.128E-3	806	0.037	0.025	7lfhA.pdb.gz
16	PDB:6o60C	0.183	0.247	7.276E-3	389	0.044	0.062	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
17	PDB:4kxfP	0.124	0.089	9.149E-3	866	0.026	0.016	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
18	PDB:1k5dC	0.222	0.342	1.290E-2	344	0.049	0.078	1k5dC.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
19	PDB:2p1nB	0.153	0.147	1.290E-2	571	0.049	0.047	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
20	PDB:7sa1B	0.166	0.148	2.875E-2	624	0.051	0.045	7sa1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A5Q0	0.0	777	549	0.874	0.871	LMOD2_RAT Leiomodin-2 OS=Rattus norvegicus OX=10116 GN=Lmod2 PE=1 SV=1
2	E1BTG2	0.0	630	552	0.713	0.707	LMOD2_CHICK Leiomodin-2 OS=Gallus gallus OX=9031 GN=LMOD2 PE=1 SV=2
3	Q3UHZ5	0.0	788	550	0.872	0.867	LMOD2_MOUSE Leiomodin-2 OS=Mus musculus OX=10090 GN=Lmod2 PE=1 SV=1
4	Q6P5Q4	0.0	1108	547	1.000	1.000	LMOD2_HUMAN Leiomodin-2 OS=Homo sapiens OX=9606 GN=LMOD2 PE=1 SV=2
5	P29536	1.64e-76	254	600	0.216	0.197	LMOD1_HUMAN Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1 PE=1 SV=3
6	A0A0G2K0D3	4.15e-76	253	595	0.219	0.202	LMOD1_RAT Leiomodin-1 OS=Rattus norvegicus OX=10116 GN=Lmod1 PE=1 SV=1
7	P70566	5.47e-73	238	351	0.274	0.427	TMOD2_RAT Tropomodulin-2 OS=Rattus norvegicus OX=10116 GN=Tmod2 PE=1 SV=1
8	P70567	8.74e-73	238	359	0.269	0.409	TMOD1_RAT Tropomodulin-1 OS=Rattus norvegicus OX=10116 GN=Tmod1 PE=2 SV=1
9	Q9JKK7	9.82e-73	237	351	0.274	0.427	TMOD2_MOUSE Tropomodulin-2 OS=Mus musculus OX=10090 GN=Tmod2 PE=1 SV=2
10	P49813	1.18e-71	235	359	0.271	0.412	TMOD1_MOUSE Tropomodulin-1 OS=Mus musculus OX=10090 GN=Tmod1 PE=1 SV=2
11	Q91006	1.18e-71	235	359	0.276	0.421	Q91006_CHICK Tropomodulin OS=Gallus gallus OX=9031 PE=2 SV=1
12	G1T676	2.11e-71	234	359	0.271	0.412	G1T676_RABIT Tropomodulin 1 OS=Oryctolagus cuniculus OX=9986 GN=TMOD1 PE=4 SV=1
13	Q9NZR1	2.40e-71	234	351	0.274	0.427	TMOD2_HUMAN Tropomodulin-2 OS=Homo sapiens OX=9606 GN=TMOD2 PE=1 SV=1
14	E7F7X0	9.00e-69	236	670	0.201	0.164	LMOD3_DANRE Leiomodin-3 OS=Danio rerio OX=7955 GN=lmod3 PE=1 SV=1
15	P28289	2.10e-68	226	359	0.263	0.401	TMOD1_HUMAN Tropomodulin-1 OS=Homo sapiens OX=9606 GN=TMOD1 PE=1 SV=1
16	Q9NYL9	2.93e-67	223	352	0.278	0.432	TMOD3_HUMAN Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1
17	Q9DEA6	3.96e-66	220	345	0.265	0.420	Q9DEA6_CHICK Tropomodulin (Fragment) OS=Gallus gallus OX=9031 GN=E-Tmod PE=1 SV=1
18	Q9JHJ0	1.49e-63	213	352	0.261	0.406	TMOD3_MOUSE Tropomodulin-3 OS=Mus musculus OX=10090 GN=Tmod3 PE=1 SV=1
19	E9QA62	5.56e-63	218	571	0.227	0.217	LMOD3_MOUSE Leiomodin-3 OS=Mus musculus OX=10090 GN=Lmod3 PE=1 SV=1
20	Q0VAK6	3.20e-62	216	560	0.179	0.175	LMOD3_HUMAN Leiomodin-3 OS=Homo sapiens OX=9606 GN=LMOD3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03250 Tropomodulin	6.2e-13	60.3	Tropomodulin
2	PF02205 WH2	7.1	17.8	WH2 motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411932

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306997	0.802	Myozenin-2
2	9606.ENSP00000431813	0.784	Cysteine and glycine-rich protein 3
3	9606.ENSP00000401437	0.775	LIM domain-binding protein 3
4	9606.ENSP00000467141	0.756	Titin
5	9606.ENSP00000397655	0.726	Ankyrin repeat and SOCS box protein 15
6	9606.ENSP00000484342	0.718	Nebulin
7	9606.ENSP00000350132	0.715	Cardiac phospholamban
8	9606.ENSP00000417769	0.700	IQ and ubiquitin-like domain-containing protein
9	9606.ENSP00000261448	0.693	Calsequestrin-2
10	9606.ENSP00000439281	0.690	Triadin
11	9606.ENSP00000368808	0.688	Small muscular protein
12	9606.ENSP00000378289	0.678	Synaptopodin 2-like protein
13	9606.ENSP00000262113	0.649	Myomesin-2
14	9606.ENSP00000268876	0.649	Protein unc-45 homolog B
15	9606.ENSP00000309087	0.642	PLAC8-like protein 1
16	9606.ENSP00000378912	0.640	Protein cordon-bleu
17	9606.ENSP00000256854	0.638	Asparagine--tRNA ligase, cytoplasmic
18	9606.ENSP00000479134	0.620	Formin-1
19	9606.ENSP00000310111	0.612	Heat shock protein family B member 7
20	9606.ENSP00000410910	0.612	Musculoskeletal embryonic nuclear protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005523	1.000	tropomyosin binding
GO:0003785	1.000	actin monomer binding
GO:0044877	0.523	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0051146	0.989	striated muscle cell differentiation
GO:0030036	0.988	actin cytoskeleton organization
GO:0097435	0.985	supramolecular fiber organization
GO:0048646	0.985	anatomical structure formation involved in morphogenesis
GO:0032989	0.982	cellular component morphogenesis
GO:0048468	0.964	cell development
GO:0140694	0.957	non-membrane-bounded organelle assembly
GO:0010927	0.957	cellular component assembly involved in morphogenesis
GO:0055001	0.945	muscle cell development
GO:0030239	0.935	myofibril assembly
GO:0065007	0.856	biological regulation
GO:0050789	0.844	regulation of biological process
GO:0045214	0.830	sarcomere organization
GO:0050794	0.731	regulation of cellular process
GO:0048522	0.480	positive regulation of cellular process
GO:0007015	0.446	actin filament organization
GO:0032501	0.353	multicellular organismal process
GO:0051128	0.334	regulation of cellular component organization
GO:0065008	0.315	regulation of biological quality
GO:0032970	0.315	regulation of actin filament-based process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030017	0.999	sarcomere
GO:0031672	0.991	A band
GO:0031430	0.957	M band
GO:0015629	0.943	actin cytoskeleton
GO:0099513	0.699	polymeric cytoskeletal fiber
GO:0005884	0.580	actin filament
GO:0005829	0.519	cytosol
GO:0043227	0.398	membrane-bounded organelle
GO:0043231	0.364	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]