StarFunc result for job id Q6P988

User Input

>input (496 residues)
MGRGVRVLLLLSLLHCAGGSEGRKTWRRRGQQPPPPPRTEAAPAAGQPVESFPLDFTAVE
GNMDSFMAQVKSLAQSLYPCSAQQLNEDLRLHLLLNTSVTCNDGSPAGYYLKESRGSRRW
LLFLEGGWYCFNRENCDSRYDTMRRLMSSRDWPRTRTGTGILSSQPEENPYWWNANMVFI
PYCSSDVWSGASSKSEKNEYAFMGALIIQEVVRELLGRGLSGAKVLLLAGSSAGGTGVLL
NVDRVAEQLEKLGYPAIQVRGLADSGWFLDNKQYRHTDCVDTITCAPTEAIRRGIRYWNG
VVPERCRRQFQEGEEWNCFFGYKVYPTLRCPVFVVQWLFDEAQLTVDNVHLTGQPVQEGL
RLYIQNLGRELRHTLKDVPASFAPACLSHEIIIRSHWTDVQVKGTSLPRALHCWDRSLHD
SHKASKTPLKGCPVHLVDSCPWPHCNPSCPTVRDQFTGQEMNVAQFLMHMGFDMQTVAQP
QGLEPSELLGMLSNGS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZXI3	0.918	0.905	3.220E-96	503	0.907	0.895	D3ZXI3.pdb.gz	D3ZXI3_RAT NOTUM, palmitoleoyl-protein carboxylesterase OS=Rattus norvegicus OX=10116 GN=Notum PE=3 SV=1
2	AFDB:A0A0D3QS98	0.921	0.935	1.033E-84	488	0.738	0.750	A0A0D3QS98.pdb.gz	NOT1P_XENLA Palmitoleoyl-protein carboxylesterase notum1' OS=Xenopus laevis OX=8355 GN=notum1' PE=2 SV=1
3	AFDB:C5H5C4	0.858	0.851	4.851E-81	500	0.716	0.710	C5H5C4.pdb.gz	NOT1A_DANRE Palmitoleoyl-protein carboxylesterase notum1a OS=Danio rerio OX=7955 GN=notum1a PE=2 SV=1
4	PDB:4uyzD	0.735	0.986	1.514E-70	369	0.744	1.000	4uyzD.pdb.gz
5	AFDB:E7F0Z8	0.788	0.789	3.642E-62	495	0.506	0.507	E7F0Z8.pdb.gz	NOTU2_DANRE Carboxylesterase notum2 OS=Danio rerio OX=7955 GN=notum2 PE=2 SV=1
6	AFDB:Q9VUX3	0.728	0.544	3.996E-48	671	0.405	0.300	Q9VUX3.pdb.gz	NOTUM_DROME Palmitoleoyl-protein carboxylesterase NOTUM OS=Drosophila melanogaster OX=7227 GN=Notum PE=1 SV=3
7	AFDB:Q9FH82	0.634	0.795	7.768E-26	391	0.175	0.223	Q9FH82.pdb.gz	PAE11_ARATH Pectin acetylesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PAE11 PE=2 SV=1
8	AFDB:Q940J8	0.626	0.785	1.178E-25	391	0.175	0.223	Q940J8.pdb.gz	PAE7_ARATH Pectin acetylesterase 7 OS=Arabidopsis thaliana OX=3702 GN=PAE7 PE=2 SV=1
9	AFDB:O80731	0.596	0.704	3.876E-25	416	0.196	0.233	O80731.pdb.gz	PAE3_ARATH Pectin acetylesterase 3 OS=Arabidopsis thaliana OX=3702 GN=PAE3 PE=2 SV=1
10	AFDB:B9DFR3	0.580	0.635	5.323E-24	451	0.167	0.184	B9DFR3.pdb.gz	PAE9_ARATH Pectin acetylesterase 9 OS=Arabidopsis thaliana OX=3702 GN=PAE9 PE=2 SV=1
11	PDB:4kryE	0.295	0.413	6.514E-7	329	0.099	0.149	4kryE.pdb.gz
12	PDB:3fcxB	0.283	0.467	8.773E-7	275	0.071	0.127	3fcxB.pdb.gz	Crystal structure of human esterase D: a potential genetic marker of retinoblastoma
13	AFDB:Q1PET6	0.297	0.337	3.278E-6	422	0.097	0.114	Q1PET6.pdb.gz	ICML2_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2 OS=Arabidopsis thaliana OX=3702 GN=ICMEL2 PE=2 SV=1
14	PDB:5kwiA	0.342	0.547	7.941E-6	283	0.081	0.141	5kwiA.pdb.gz	Exploring Covalent Allosteric Inhibition of Antigen 85C from Mycobacterium tuberculosis by Ebselen Derivatives.
15	PDB:5l2pA	0.261	0.387	1.008E-5	306	0.075	0.121	5l2pA.pdb.gz
16	PDB:1f0pA	0.288	0.454	2.185E-5	284	0.058	0.102	1f0pA.pdb.gz	An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
17	PDB:1r88A	0.291	0.486	2.772E-5	267	0.056	0.105	1r88A.pdb.gz
18	PDB:3c6bA	0.269	0.406	5.028E-5	291	0.081	0.137	3c6bA.pdb.gz
19	PDB:2zsiA	0.262	0.351	7.187E-5	339	0.101	0.147	2zsiA.pdb.gz	Gibberellin-induced DELLA recognition by the gibberellin receptor GID1
20	PDB:3kxpA	0.217	0.367	8.593E-5	268	0.089	0.164	3kxpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0D3QS98	0.0	771	488	0.726	0.738	NOT1P_XENLA Palmitoleoyl-protein carboxylesterase notum1' OS=Xenopus laevis OX=8355 GN=notum1' PE=2 SV=1
2	A0A0D3QS99	0.0	790	488	0.736	0.748	NOT1_XENLA Palmitoleoyl-protein carboxylesterase notum1 OS=Xenopus laevis OX=8355 GN=notum1 PE=2 SV=1
3	C5H5C4	0.0	776	500	0.740	0.734	NOT1A_DANRE Palmitoleoyl-protein carboxylesterase notum1a OS=Danio rerio OX=7955 GN=notum1a PE=2 SV=1
4	D3ZXI3	0.0	911	503	0.907	0.895	D3ZXI3_RAT NOTUM, palmitoleoyl-protein carboxylesterase OS=Rattus norvegicus OX=10116 GN=Notum PE=3 SV=1
5	E7F0Z8	0.0	536	495	0.518	0.519	NOTU2_DANRE Carboxylesterase notum2 OS=Danio rerio OX=7955 GN=notum2 PE=2 SV=1
6	Q6P988	0.0	1032	496	1.000	1.000	NOTUM_HUMAN Palmitoleoyl-protein carboxylesterase NOTUM OS=Homo sapiens OX=9606 GN=NOTUM PE=1 SV=2
7	Q8R116	0.0	912	503	0.909	0.897	NOTUM_MOUSE Palmitoleoyl-protein carboxylesterase NOTUM OS=Mus musculus OX=10090 GN=Notum PE=1 SV=2
8	Q9VUX3	7.26e-104	327	671	0.327	0.241	NOTUM_DROME Palmitoleoyl-protein carboxylesterase NOTUM OS=Drosophila melanogaster OX=7227 GN=Notum PE=1 SV=3
9	Q940J8	9.16e-23	102	391	0.185	0.235	PAE7_ARATH Pectin acetylesterase 7 OS=Arabidopsis thaliana OX=3702 GN=PAE7 PE=2 SV=1
10	O80731	9.47e-23	102	416	0.149	0.178	PAE3_ARATH Pectin acetylesterase 3 OS=Arabidopsis thaliana OX=3702 GN=PAE3 PE=2 SV=1
11	Q9FH82	3.75e-20	94.4	391	0.133	0.169	PAE11_ARATH Pectin acetylesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PAE11 PE=2 SV=1
12	B9DFR3	2.04e-18	89.7	451	0.145	0.160	PAE9_ARATH Pectin acetylesterase 9 OS=Arabidopsis thaliana OX=3702 GN=PAE9 PE=2 SV=1
13	D0IQL1	0.092	37.7	830	0.040	0.024	D0IQL1_DROME Leucine-rich tendon-specific protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Lrt PE=2 SV=1
14	A1ZBX8	0.094	37.7	808	0.040	0.025	A1ZBX8_DROME Leucine-rich tendon-specific protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Lrt PE=4 SV=2
15	Q38B13	0.54	35.4	756	0.044	0.029	Q38B13_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0990 PE=4 SV=1
16	C3U1W5	2.5	33.1	431	0.079	0.090	C3U1W5_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=Smad6 PE=2 SV=1
17	Q9W734	3.2	32.7	431	0.079	0.090	SMAD6_CHICK Mothers against decapentaplegic homolog 6 OS=Gallus gallus OX=9031 GN=SMAD6 PE=2 SV=1
18	A2R1E3	5.2	32.0	422	0.034	0.040	A2R1E3_ASPNC Contig An13c0040, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An13g00920 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17687 DUF5535	3.4e+02	12.8	Family of unknown function (DUF5535)
2	PF03283 PAE	7.6e-86	300.0	Pectinacetylesterase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000387310

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366267	0.964	Glypican-5
2	9606.ENSP00000297261	0.933	Sonic hedgehog protein
3	9606.ENSP00000293549	0.926	Proto-oncogene Wnt-1
4	9606.ENSP00000266991	0.919	Desert hedgehog protein
5	9606.ENSP00000295731	0.919	Indian hedgehog protein
6	9606.ENSP00000285018	0.915	Protein Wnt-7a
7	9606.ENSP00000377836	0.850	Glypican-3
8	9606.ENSP00000284523	0.838	Protein Wnt-3a
9	9606.ENSP00000325526	0.833	Protein Wnt-11
10	9606.ENSP00000222462	0.801	Protein Wnt-16
11	9606.ENSP00000233948	0.795	Protein Wnt-6
12	9606.ENSP00000290015	0.794	Protein Wnt-9b
13	9606.ENSP00000358698	0.780	Protein Wnt-2b
14	9606.ENSP00000290167	0.779	Protein Wnt-4
15	9606.ENSP00000225512	0.777	Proto-oncogene Wnt-3
16	9606.ENSP00000272164	0.777	Protein Wnt-9a
17	9606.ENSP00000264634	0.771	Protein Wnt-5a
18	9606.ENSP00000380379	0.769	Protein Wnt-5b
19	9606.ENSP00000264039	0.766	Glypican-1
20	9606.ENSP00000359864	0.766	Glypican-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016298	1.000	lipase activity
GO:1990699	1.000	palmitoleyl hydrolase activity
GO:0004620	0.992	phospholipase activity
GO:0042578	0.991	phosphoric ester hydrolase activity
GO:0005515	0.982	protein binding
GO:0004629	0.936	phospholipase C activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0048856	0.995	anatomical structure development
GO:0060348	0.989	bone development
GO:0050794	0.988	regulation of cellular process
GO:2000026	0.986	regulation of multicellular organismal development
GO:0048519	0.971	negative regulation of biological process
GO:0048583	0.970	regulation of response to stimulus
GO:0070167	0.970	regulation of biomineral tissue development
GO:0030278	0.967	regulation of ossification
GO:0009966	0.963	regulation of signal transduction
GO:0048523	0.950	negative regulation of cellular process
GO:0030111	0.947	regulation of Wnt signaling pathway
GO:0030178	0.907	negative regulation of Wnt signaling pathway
GO:0008152	0.898	metabolic process
GO:0030500	0.897	regulation of bone mineralization
GO:0098732	0.893	macromolecule deacylation
GO:0035601	0.859	protein deacylation
GO:0009987	0.655	cellular process
GO:0042157	0.568	lipoprotein metabolic process
GO:0030163	0.554	protein catabolic process
GO:0060828	0.380	regulation of canonical Wnt signaling pathway
GO:0048518	0.308	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005788	0.997	endoplasmic reticulum lumen
GO:0071944	0.955	cell periphery
GO:0005886	0.938	plasma membrane
GO:0043230	0.734	extracellular organelle
GO:0005615	0.665	extracellular space
GO:0031982	0.630	vesicle
GO:0070062	0.445	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.1.-	1.000	Carboxylic ester hydrolases.
EC:3.1.4.-	0.938	Phosphoric diester hydrolases.

[back to server]