StarFunc result for job id Q6P9B6

User Input

>input (456 residues)
MGNSRSRVGRSFCSQFLPEEQAEIDQLFDALSSDKNSPNVSSKSFSLKALQNHVGEALPP
EMVTRLYDGMRRVDLTGKAKGPSENVSQEQFTASMSHLLKGNSEEKSLMIMKMISATEGP
VKAREVQKFTEDLVGSVVHVLSHRQELRGWTGKEAPGPNPRVQVLAAQLLSDMKLQDGKR
LLGPQWLDYDCDRAVIEDWVFRVPHVAIFLSVVICKGFLILCSSLDLTTLVPERQVDQGR
GFESILDVLSVMYINAQLPREQRHRWCLLFSSELHGHSFSQLCGHITHRGPCVAVLEDHD
KHVFGGFASCSWEVKPQFQGDNRCFLFSICPSMAVYTHTGYNDHYMYLNHGQQTIPNGLG
MGGQHNYFGLWVDVDFGKGHSRAKPTCTTYNSPQLSAQENFQFDKMEVWAVGDPSEEQLA
KGNKSILDADPEAQALLEISGHSRHSEGLREVPDDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K5C2	0.977	0.977	1.188E-87	456	0.991	0.991	A8K5C2.pdb.gz	A8K5C2_HUMAN cDNA FLJ75055 OS=Homo sapiens OX=9606 PE=2 SV=1
2	PDB:7uneU	0.877	0.935	7.521E-70	427	0.932	0.995	7uneU.pdb.gz
3	AFDB:Q8K0P3	0.926	0.928	2.710E-63	455	0.654	0.655	Q8K0P3.pdb.gz	MEAK7_MOUSE MTOR-associated protein MEAK7 OS=Mus musculus OX=10090 GN=Meak7 PE=2 SV=1
4	AFDB:Q21342	0.649	0.729	4.868E-27	399	0.213	0.243	Q21342.pdb.gz	Q21342_CAEEL TLDc domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eak-7 PE=1 SV=1
5	AFDB:Q8IPN9	0.359	0.161	3.930E-16	1055	0.154	0.066	Q8IPN9.pdb.gz	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
6	AFDB:Q7KTR8	0.359	0.599	7.954E-16	267	0.132	0.225	Q7KTR8.pdb.gz	Q7KTR8_DROME L82D OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
7	AFDB:A4V2F2	0.344	0.129	8.397E-16	1246	0.114	0.042	A4V2F2.pdb.gz	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
8	AFDB:A0A0B4K699	0.355	0.144	1.043E-15	1158	0.127	0.050	A0A0B4K699.pdb.gz	A0A0B4K699_DROME Mustard, isoform Y OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	AFDB:A0A0B4K620	0.358	0.127	1.610E-15	1344	0.167	0.057	A0A0B4K620.pdb.gz	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
10	AFDB:Q9FKA3	0.457	0.399	1.610E-15	542	0.189	0.159	Q9FKA3.pdb.gz	Q9FKA3_ARATH TLD-domain containing nucleolar protein OS=Arabidopsis thaliana OX=3702 GN=OXR5 PE=1 SV=1
11	AFDB:Q9VNA1	0.355	0.132	1.895E-15	1270	0.129	0.046	Q9VNA1.pdb.gz	Q9VNA1_DROME L82A OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=2
12	PDB:7fdeP	0.337	0.811	1.190E-10	181	0.099	0.249	7fdeP.pdb.gz
13	PDB:1s1eA	0.281	0.599	2.448E-4	181	0.055	0.138	1s1eA.pdb.gz	Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1.
14	PDB:7ukhI	0.272	0.594	3.578E-4	181	0.057	0.144	7ukhI.pdb.gz	Activation and closed-state inactivation mechanisms of the human voltage-gated K V 4 channel complexes.
15	PDB:5aanA	0.260	0.573	4.211E-4	183	0.059	0.148	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
16	PDB:1v1fA	0.283	0.601	5.231E-4	188	0.061	0.149	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
17	PDB:1omrA	0.251	0.502	1.180E-3	201	0.050	0.114	1omrA.pdb.gz	Impact of N-terminal myristoylation on the Ca2+-dependent conformational transition in recoverin
18	PDB:6tz8B	0.231	0.506	1.634E-3	174	0.061	0.161	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
19	PDB:4il1A	0.228	0.202	2.811E-3	529	0.072	0.062	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
20	PDB:5x9aB	0.260	0.515	3.492E-3	198	0.053	0.121	5x9aB.pdb.gz	Crystal structure of a Ca2+-dependent regulator of flagellar motility reveals the open-closed structural transition

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K5C2	0.0	944	456	0.991	0.991	A8K5C2_HUMAN cDNA FLJ75055 OS=Homo sapiens OX=9606 PE=2 SV=1
2	Q6P9B6	0.0	952	456	1.000	1.000	MEAK7_HUMAN MTOR-associated protein MEAK7 OS=Homo sapiens OX=9606 GN=MEAK7 PE=1 SV=2
3	Q8K0P3	0.0	624	455	0.654	0.655	MEAK7_MOUSE MTOR-associated protein MEAK7 OS=Mus musculus OX=10090 GN=Meak7 PE=2 SV=1
4	Q21342	1.37e-40	151	399	0.171	0.195	Q21342_CAEEL TLDc domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=eak-7 PE=1 SV=1
5	Q8IPN7	1.83e-19	89.0	213	0.116	0.249	Q8IPN7_DROME L82E OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
6	Q7KNC5	2.89e-19	93.2	1025	0.116	0.052	Q7KNC5_DROME L82B OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
7	Q8IPN9	3.11e-19	93.2	1055	0.116	0.050	Q8IPN9_DROME Mustard, isoform K OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
8	Q8MSQ5	3.20e-19	93.2	1033	0.116	0.051	Q8MSQ5_DROME Mustard, isoform G OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
9	Q8IPN6	3.27e-19	87.4	192	0.116	0.276	Q8IPN6_DROME L82G OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
10	B7Z0T3	3.53e-19	93.2	1106	0.116	0.048	B7Z0T3_DROME Mustard, isoform S OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
11	B7Z0T6	3.65e-19	92.8	789	0.116	0.067	B7Z0T6_DROME Mustard, isoform R OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
12	Q7KTR7	3.85e-19	87.8	210	0.116	0.252	Q7KTR7_DROME L82F OS=Drosophila melanogaster OX=7227 GN=mtd PE=2 SV=1
13	A0A0B4K6S8	3.92e-19	92.8	1180	0.116	0.045	A0A0B4K6S8_DROME Mustard, isoform W OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
14	Q9VNA2	4.03e-19	92.8	1127	0.116	0.047	Q9VNA2_DROME Mustard, isoform X OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=3
15	Q9VNA1	4.06e-19	92.8	1270	0.116	0.042	Q9VNA1_DROME L82A OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=2
16	Q0KIB9	4.41e-19	92.8	1314	0.116	0.040	Q0KIB9_DROME Mustard, isoform P OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
17	A0A0B4K620	4.44e-19	92.8	1344	0.116	0.039	A0A0B4K620_DROME Mustard, isoform V OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
18	Q8IPN8	4.59e-19	92.4	869	0.116	0.061	Q8IPN8_DROME L82C OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
19	A4V2F2	4.66e-19	92.8	1246	0.116	0.043	A4V2F2_DROME Mustard, isoform U OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1
20	A0A0B4KF88	4.77e-19	92.4	871	0.116	0.061	A0A0B4KF88_DROME Mustard, isoform AA OS=Drosophila melanogaster OX=7227 GN=mtd PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07534 TLD	5.9e-36	135.2	TLD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343635

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359000	0.792	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1
2	9606.ENSP00000379267	0.792	Elongator complex protein 4
3	9606.ENSP00000311984	0.788	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
4	9606.ENSP00000386156	0.785	Partner of Y14 and mago
5	9606.ENSP00000238379	0.778	Haloacid dehalogenase like hydrolase domain containing 3
6	9606.ENSP00000269195	0.726	Polypeptide N-acetylgalactosaminyltransferase 1
7	9606.ENSP00000376570	0.726	Polypeptide N-acetylgalactosaminyltransferase 13
8	9606.ENSP00000394183	0.704	CDKN2AIP N-terminal-like protein
9	9606.ENSP00000427108	0.704	CDKN2A-interacting protein
10	9606.ENSP00000266269	0.641	POZ-, AT hook-, and zinc finger-containing protein 1
11	9606.ENSP00000332407	0.611	Short chain dehydrogenase/reductase family 42E, member 1
12	9606.ENSP00000272732	0.607	Secernin-3
13	9606.ENSP00000371051	0.607	Zinc finger ZZ-type and EF-hand domain containing 1
14	9606.ENSP00000293970	0.590	TBC1 domain family member 24
15	9606.ENSP00000301698	0.562	Proline-rich protein 25
16	9606.ENSP00000450864	0.562	Serine/threonine-protein phosphatase 4 regulatory subunit 3A
17	9606.ENSP00000483228	0.549	Serine/threonine-protein phosphatase 4 regulatory subunit 3B
18	9606.ENSP00000342962	0.547	Serine incorporator 1
19	9606.ENSP00000351832	0.545	Rab3 GTPase-activating protein non-catalytic subunit
20	9606.ENSP00000365007	0.516	DnaJ heat shock protein family member C16

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0050896	0.925	response to stimulus
GO:0042221	0.781	response to chemical
GO:1901698	0.749	response to nitrogen compound
GO:0051716	0.727	cellular response to stimulus
GO:0048518	0.721	positive regulation of biological process
GO:0010243	0.695	response to organonitrogen compound
GO:0048522	0.614	positive regulation of cellular process
GO:0048583	0.591	regulation of response to stimulus
GO:1901700	0.559	response to oxygen-containing compound
GO:0048519	0.537	negative regulation of biological process
GO:1901652	0.526	response to peptide
GO:0042127	0.513	regulation of cell population proliferation
GO:0048523	0.464	negative regulation of cellular process
GO:0009605	0.445	response to external stimulus
GO:1902882	0.437	regulation of response to oxidative stress
GO:0032879	0.413	regulation of localization
GO:0007154	0.402	cell communication
GO:0001101	0.385	response to acid chemical
GO:0035556	0.369	intracellular signal transduction
GO:0031929	0.355	TOR signaling
GO:0009725	0.345	response to hormone
GO:0040012	0.343	regulation of locomotion
GO:0043200	0.331	response to amino acid
GO:0032868	0.325	response to insulin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005765	1.000	lysosomal membrane
GO:0070013	0.979	intracellular organelle lumen
GO:0005634	0.879	nucleus
GO:0031981	0.797	nuclear lumen
GO:0005654	0.516	nucleoplasm
GO:0043232	0.457	intracellular non-membrane-bounded organelle
GO:0005829	0.434	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]