StarFunc result for job id Q6P9B9

User Input

>input (1019 residues)
MSALCDPPGAPGPPGPAPATHGPAPLSAQELSQEIKAFLTGVDPILGHQLSAREHARCGL
LLLRSLPPARAAVLDHLRGVFDESVRAHLAALDETPVAGPPHLRPPPPSHVPAGGPGLED
VVQEVQQVLSEFIRANPKAWAPVISAWSIDLMGQLSSTYSGQHQRVPHATGALNELLQLW
MGCRATRTLMDIYVQCLSALIGSCPDACVDALLDTSVQHSPHFDWVVAHIGSSFPGTIIS
RVLSCGLKDFCVHGGAGGGAGSSGGSSSQTPSTDPFPGSPAIPAEKRVPKIASVVGILGH
LASRHGDSIRRELLRMFHDSLAGGSGGRSGDPSLQATVPFLLQLAVMSPALLGTVSGELV
DCLKPPAVLSQLQQHLQGFPREELDNMLNLAVHLVSQASGAGAYRLLQFLVDTAMPASVI
TTQGLAVPDTVREACDRLIQLLLLHLQKLVHHRGGSPGEGVLGPPPPPRLVPFLDALKNH
VGELCGETLRLERKRFLWQHQLLGLLSVYTRPSCGPEALGHLLSRARSPEELSLATQLYA
GLVVSLSGLLPLAFRSCLARVHAGTLQPPFTARFLRNLALLVGWEQQGGEGPAALGAHFG
ESASAHLSDLAPLLLHPEEEVAEAAASLLAICPFPSEALSPSQLLGLVRAGVHRFFASLR
LHGPPGVASACQLLTRLSQTSPAGLKAVLQLLVEGALHRGNTELFGGQVDGDNETLSVVS
ASLASASLLDTNRRHTAAVPGPGGIWSVFHAGVIGRGLKPPKFVQSRNQQEVIYNTQSLL
SLLVHCCSAPGGTECGECWGAPILSPEAAKAVAVTLVESVCPDAAGAELAWPPEEHARAT
VERDLRIGRRFREQPLLFELLKLVAAAPPALCYCSVLLRGLLAALLGHWEASRHPDTTHS
PWHLEASCTLVAVMAEGSLLPPALGNMHEVFSQLAPFEVRLLLLSVWGFLREHGPLPQKF
IFQSERGRFIRDFSREGGGEGGPHLAVLHSVLHRNIDRLGLFSGRFQAPSPSTLLRQGT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9B9	1.000	1.000	0.000	1019	1.000	1.000	Q6P9B9.pdb.gz	INT5_HUMAN Integrator complex subunit 5 OS=Homo sapiens OX=9606 GN=INTS5 PE=1 SV=1
2	AFDB:A0A0R4IY96	0.839	0.835	2.511E-68	1023	0.526	0.524	A0A0R4IY96.pdb.gz	A0A0R4IY96_DANRE Integrator complex subunit 5 OS=Danio rerio OX=7955 GN=ints5 PE=1 SV=1
3	PDB:7pkse	0.595	0.923	3.852E-58	649	0.637	1.000	7pkse.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
4	PDB:7cunE	0.494	0.623	2.391E-54	796	0.777	0.995	7cunE.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
5	AFDB:Q9VFS6	0.699	0.714	1.740E-28	994	0.223	0.228	Q9VFS6.pdb.gz	INT5_DROME Integrator complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=omd PE=1 SV=2
6	AFDB:Q9VKY2	0.156	0.134	8.333E-6	1248	0.126	0.103	Q9VKY2.pdb.gz	CAND1_DROME Cullin-associated NEDD8-dissociated protein 1 OS=Drosophila melanogaster OX=7227 GN=Cand1 PE=2 SV=1
7	AFDB:Q5JTH9	0.159	0.136	9.269E-6	1297	0.124	0.097	Q5JTH9.pdb.gz	RRP12_HUMAN RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12 PE=1 SV=2
8	AFDB:E9PVA8	0.134	0.067	1.147E-5	2671	0.129	0.049	E9PVA8.pdb.gz	GCN1_MOUSE Stalled ribosome sensor GCN1 OS=Mus musculus OX=10090 GN=Gcn1 PE=1 SV=1
9	PDB:4jlqA	0.138	0.155	1.216E-5	840	0.113	0.137	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
10	AFDB:Q9Y7K2	0.149	0.079	1.885E-5	2337	0.132	0.057	Q9Y7K2.pdb.gz	TOR2_SCHPO Serine/threonine-protein kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tor2 PE=1 SV=2
11	PDB:7yxxA	0.143	0.099	2.223E-5	1754	0.105	0.061	7yxxA.pdb.gz
12	PDB:4c0qA	0.134	0.148	2.386E-5	871	0.124	0.145	4c0qA.pdb.gz	Structural Basis for Nuclear Import of Splicing Factors by Human Transportin 3.
13	PDB:4a0cA	0.151	0.136	2.655E-5	1155	0.129	0.113	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	AFDB:O76331	0.148	0.165	2.689E-5	893	0.121	0.138	O76331.pdb.gz	O76331_DROME Transportin OS=Drosophila melanogaster OX=7227 GN=Tnpo PE=2 SV=1
15	AFDB:P32767	0.147	0.141	3.099E-5	1081	0.130	0.122	P32767.pdb.gz	KA122_YEAST Importin beta-like protein KAP122 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KAP122 PE=1 SV=1
16	PDB:6gx9A	0.125	0.134	3.527E-5	912	0.127	0.141	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
17	AFDB:Q06156	0.181	0.168	3.974E-5	1176	0.098	0.085	Q06156.pdb.gz	CND1_YEAST Condensin complex subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YCS4 PE=1 SV=1
18	PDB:7wttK	0.171	0.171	4.364E-5	1022	0.129	0.128	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
19	PDB:7mqaLM	0.222	0.136	6.923E-5	2041	0.132	0.066	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6n1zA	0.157	0.164	7.979E-5	961	0.132	0.139	6n1zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IY96	0.0	920	1023	0.525	0.523	A0A0R4IY96_DANRE Integrator complex subunit 5 OS=Danio rerio OX=7955 GN=ints5 PE=1 SV=1
2	Q6P9B9	0.0	2012	1019	1.000	1.000	INT5_HUMAN Integrator complex subunit 5 OS=Homo sapiens OX=9606 GN=INTS5 PE=1 SV=1
3	Q9VFS6	4.68e-22	105	994	0.098	0.101	INT5_DROME Integrator complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=omd PE=1 SV=2
4	P9WMU1	0.67	35.8	260	0.023	0.088	WAG31_MYCTU Cell wall synthesis protein Wag31 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wag31 PE=1 SV=1
5	Q96DG6	3.0	33.5	245	0.017	0.069	CMBL_HUMAN Carboxymethylenebutenolidase homolog OS=Homo sapiens OX=9606 GN=CMBL PE=1 SV=1
6	Q9LFD5	3.3	33.5	259	0.026	0.104	BPA1_ARATH Binding partner of ACD11 1 OS=Arabidopsis thaliana OX=3702 GN=BPA1 PE=1 SV=1
7	O67931	3.4	33.9	430	0.020	0.047	SQRD_AQUAE Sulfide-quinone reductase OS=Aquifex aeolicus (strain VF5) OX=224324 GN=sqr PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14838 INTS5_C	4.3e-254	857.0	Integrator complex subunit 5 C-terminus
2	PF14837 INTS5_N	2.3e-73	257.8	Integrator complex subunit 5 N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327889

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355961	0.999	Integrator complex subunit 7
2	9606.ENSP00000429065	0.998	Integrator complex subunit 9
3	9606.ENSP00000434466	0.998	Integrator complex subunit 4
4	9606.ENSP00000430338	0.996	Integrator complex subunit 8
5	9606.ENSP00000385722	0.995	Integrator complex subunit 1
6	9606.ENSP00000445001	0.995	Integrator complex subunit 11
7	9606.ENSP00000414237	0.994	Integrator complex subunit 2
8	9606.ENSP00000310260	0.992	Integrator complex subunit 6
9	9606.ENSP00000381064	0.986	Integrator complex subunit 10
10	9606.ENSP00000318641	0.975	Integrator complex subunit 3
11	9606.ENSP00000415433	0.975	Integrator complex subunit 12
12	9606.ENSP00000408429	0.953	Integrator complex subunit 14
13	9606.ENSP00000418447	0.902	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
14	9606.ENSP00000261191	0.888	Integrator complex subunit 13
15	9606.ENSP00000301788	0.878	DNA-directed RNA polymerase II subunit RPB7
16	9606.ENSP00000480158	0.857	DNA-directed RNA polymerase II subunit RPB1
17	9606.ENSP00000476948	0.825	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
18	9606.ENSP00000301785	0.788	Heterogeneous nuclear ribonucleoprotein U like 2
19	9606.ENSP00000369545	0.776	SOSS complex subunit B1
20	9606.ENSP00000340220	0.763	Uncharacterized protein C7orf26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016180	0.987	snRNA processing
GO:0065007	0.405	biological regulation
GO:0050794	0.385	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005829	0.999	cytosol
GO:0140513	0.999	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0032039	0.485	integrator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]