StarFunc result for job id Q6P9H4

User Input

>input (555 residues)
MEPVTKWSPKQVVDWTRGLDDCLQQYVHKFEREKINGEQLLQISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKAPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDFSVTKNKIIQLCLDLTTTVQKDCFVAEMEDKV
LTVVKVLNGICDKTIRSTTDPVMSQCACLEEVHLPNIKPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNQQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFNFT
PAPLKNLRWKPPLVQTSPPPATTQSPESTMDTSLKKEKSAILDLYIPPPPAVPYSPRDEN
GSFVYGGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMR
EKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRYFSNERIPPIIEESSSP
PYRFSRPTTERHLVRGADYIRGSRCYINSDLHSSATIPFQEEGTKKKSGSSATKSSSTEP
SLLVSWFTRLKLLTH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6P9H4	1.000	1.000	1.841E-84	555	1.000	1.000	Q6P9H4.pdb.gz	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
2	AFDB:G9CGD6	0.569	0.356	2.601E-67	899	0.832	0.514	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
3	AFDB:Q8WXI2	0.552	0.300	6.310E-49	1034	0.559	0.300	Q8WXI2.pdb.gz	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
4	AFDB:Q7KNQ9	0.478	0.178	3.568E-26	1557	0.265	0.094	Q7KNQ9.pdb.gz	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
5	AFDB:O35889	0.149	0.054	2.652E-6	1829	0.153	0.046	O35889.pdb.gz	AFAD_RAT Afadin OS=Rattus norvegicus OX=10116 GN=Afdn PE=1 SV=1
6	AFDB:Q9VKG8	0.147	0.046	1.861E-5	1916	0.169	0.049	Q9VKG8.pdb.gz	Q9VKG8_DROME Discs large 5, isoform A OS=Drosophila melanogaster OX=7227 GN=Dlg5 PE=1 SV=1
7	AFDB:Q4ZGL5	0.144	0.135	2.421E-5	596	0.097	0.091	Q4ZGL5.pdb.gz
8	AFDB:Q8NEN9	0.149	0.075	3.689E-5	1154	0.103	0.049	Q8NEN9.pdb.gz	PDZD8_HUMAN PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1
9	AFDB:E7FCN3	0.167	0.144	3.889E-5	649	0.097	0.083	E7FCN3.pdb.gz
10	AFDB:F1MAD2	0.151	0.049	1.115E-4	1836	0.105	0.032	F1MAD2.pdb.gz	INADL_RAT InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2
11	PDB:2xkxA	0.153	0.119	2.917E-4	721	0.036	0.028	2xkxA.pdb.gz
12	PDB:7pc3A	0.146	0.198	4.685E-4	405	0.041	0.057	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:6t36A	0.145	0.780	1.032E-3	93	0.029	0.172	6t36A.pdb.gz	Molecular basis of the interaction of the human tyrosine phosphatase PTPN3 with the hepatitis B virus core protein.
14	PDB:7qqmA	0.147	0.196	1.573E-3	413	0.040	0.053	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7pe9I	0.140	0.239	1.942E-3	317	0.022	0.038	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.
16	PDB:2l4tA	0.141	0.572	3.119E-3	124	0.041	0.185	2l4tA.pdb.gz	Promiscuous binding at the crossroads of numerous cancer pathways: insight from the binding of glutaminase interacting protein with glutaminase L.
17	PDB:7p70A	0.142	0.193	3.119E-3	407	0.036	0.049	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7p73A	0.146	0.191	3.287E-3	420	0.041	0.055	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
19	PDB:5n7dA	0.149	0.194	8.045E-3	423	0.045	0.059	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
20	PDB:7pcbA	0.136	0.179	1.292E-2	415	0.032	0.043	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G9CGD6	0.0	956	899	0.822	0.507	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
2	Q6P9H4	0.0	1148	555	1.000	1.000	CNKR3_HUMAN Connector enhancer of kinase suppressor of ras 3 OS=Homo sapiens OX=9606 GN=CNKSR3 PE=1 SV=1
3	Q80YA9	0.0	561	1032	0.539	0.290	CNKR2_MOUSE Connector enhancer of kinase suppressor of ras 2 OS=Mus musculus OX=10090 GN=Cnksr2 PE=1 SV=1
4	Q8BMA3	0.0	1015	555	0.923	0.923	CNKR3_MOUSE Connector enhancer of kinase suppressor of ras 3 OS=Mus musculus OX=10090 GN=Cnksr3 PE=1 SV=1
5	Q8WXI2	0.0	561	1034	0.539	0.289	CNKR2_HUMAN Connector enhancer of kinase suppressor of ras 2 OS=Homo sapiens OX=9606 GN=CNKSR2 PE=1 SV=1
6	Q9Z1T4	0.0	561	1032	0.539	0.290	CNKR2_RAT Connector enhancer of kinase suppressor of ras 2 OS=Rattus norvegicus OX=10116 GN=Cnksr2 PE=1 SV=1
7	Q7KNQ9	5.76e-50	188	1557	0.186	0.066	Q7KNQ9_DROME Connector enhancer of KSR protein CNK OS=Drosophila melanogaster OX=7227 GN=cnk PE=1 SV=1
8	Q969H4	9.60e-48	179	720	0.196	0.151	CNKR1_HUMAN Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1
9	E9PUQ8	1.27e-05	50.8	1220	0.043	0.020	DGKD_MOUSE Diacylglycerol kinase delta OS=Mus musculus OX=10090 GN=Dgkd PE=1 SV=1
10	Q16760	1.35e-05	50.8	1214	0.043	0.020	DGKD_HUMAN Diacylglycerol kinase delta OS=Homo sapiens OX=9606 GN=DGKD PE=1 SV=4
11	Q86XP1	2.96e-05	49.7	1220	0.041	0.019	DGKH_HUMAN Diacylglycerol kinase eta OS=Homo sapiens OX=9606 GN=DGKH PE=1 SV=1
12	D3YXJ0	8.19e-05	48.1	1211	0.038	0.017	DGKH_MOUSE Diacylglycerol kinase eta OS=Mus musculus OX=10090 GN=Dgkh PE=1 SV=2
13	O35867	1.48e-04	47.4	1095	0.047	0.024	NEB1_RAT Neurabin-1 OS=Rattus norvegicus OX=10116 GN=Ppp1r9a PE=1 SV=1
14	Q5AWS8	2.44e-04	46.2	494	0.034	0.038	Q5AWS8_EMENI MAPKKK cascade protein kinase regulator Ste50 (AFU_orthologue AFUA_2G17130) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07252 PE=4 SV=1
15	Q80Z38	3.70e-04	46.2	1476	0.041	0.016	SHAN2_MOUSE SH3 and multiple ankyrin repeat domains protein 2 OS=Mus musculus OX=10090 GN=Shank2 PE=1 SV=2
16	Q9QX74	3.96e-04	45.8	1474	0.041	0.016	SHAN2_RAT SH3 and multiple ankyrin repeat domains protein 2 OS=Rattus norvegicus OX=10116 GN=Shank2 PE=1 SV=2
17	H9FWV3	4.32e-04	45.8	1311	0.041	0.018	H9FWV3_MACMU Neurabin-1 isoform 1 OS=Macaca mulatta OX=9544 GN=PPP1R9A PE=2 SV=1
18	Q9UPX8	4.82e-04	45.8	1849	0.041	0.012	SHAN2_HUMAN SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2 PE=1 SV=4
19	Q9ULJ8	4.98e-04	45.4	1098	0.041	0.021	NEB1_HUMAN Neurabin-1 OS=Homo sapiens OX=9606 GN=PPP1R9A PE=1 SV=2
20	Q9JLU4	8.20e-04	45.1	1740	0.041	0.013	SHAN3_RAT SH3 and multiple ankyrin repeat domains protein 3 OS=Rattus norvegicus OX=10116 GN=Shank3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06663 CNK2_3_dom	2.2e-102	352.7	Connector enhancer of kinase suppressor of ras 2/3 domain
2	PF10534 CRIC_ras_sig	4.9e-35	130.8	Connector enhancer of kinase suppressor of ras
3	PF00595 PDZ	6.9e-07	40.9	PDZ domain
4	PF13180 PDZ_2	15	17.4	PDZ domain
5	PF17820 PDZ_6	0.23	22.7	PDZ domain
6	PF02163 Peptidase_M50	1.1e+02	13.4	Peptidase family M50
7	PF00536 SAM_1	4.1e-13	60.9	SAM domain (Sterile alpha motif)
8	PF07647 SAM_2	8.6e-08	43.5	SAM domain (Sterile alpha motif)
9	PF02198 SAM_PNT	62	15.0	Sterile alpha motif (SAM)/Pointed domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000408236	0.752	Cytohesin-2
2	9606.ENSP00000357840	0.708	Sodium-dependent glucose transporter 1
3	9606.ENSP00000302599	0.682	Alpha-(1,3)-fucosyltransferase 9
4	9606.ENSP00000351697	0.670	DNA polymerase zeta catalytic subunit
5	9606.ENSP00000339958	0.621	Nischarin
6	9606.ENSP00000301180	0.603	Disco interacting protein 2 homolog B
7	9606.ENSP00000470383	0.583	Cytohesin-2
8	9606.ENSP00000453940	0.560	Coiled-coil domain containing 175
9	9606.ENSP00000224181	0.555	Complement component C8 gamma chain
10	9606.ENSP00000478061	0.552	Myristoylated alanine-rich C-kinase substrate
11	9606.ENSP00000394751	0.548	Interactor protein for cytohesin exchange factors 1
12	9606.ENSP00000351669	0.542	Glycoprotein endo-alpha-1,2-mannosidase
13	9606.ENSP00000327368	0.537	Collagen alpha-1(X) chain
14	9606.ENSP00000314173	0.505	Sterile alpha motif domain containing 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.982	regulation of cellular process
GO:0009966	0.971	regulation of signal transduction
GO:0048522	0.948	positive regulation of cellular process
GO:0065009	0.932	regulation of molecular function
GO:0019222	0.926	regulation of metabolic process
GO:0031323	0.922	regulation of cellular metabolic process
GO:0060255	0.907	regulation of macromolecule metabolic process
GO:0032409	0.885	regulation of transporter activity
GO:0009987	0.881	cellular process
GO:0051171	0.862	regulation of nitrogen compound metabolic process
GO:0080090	0.858	regulation of primary metabolic process
GO:0032879	0.768	regulation of localization
GO:0034762	0.750	regulation of transmembrane transport
GO:0051174	0.747	regulation of phosphorus metabolic process
GO:0043269	0.743	regulation of monoatomic ion transport
GO:1902531	0.723	regulation of intracellular signal transduction
GO:0022898	0.660	regulation of transmembrane transporter activity
GO:0051050	0.580	positive regulation of transport
GO:0051246	0.543	regulation of protein metabolic process
GO:0032412	0.533	regulation of monoatomic ion transmembrane transporter activity
GO:0044093	0.518	positive regulation of molecular function
GO:0034765	0.508	regulation of monoatomic ion transmembrane transport
GO:0043270	0.493	positive regulation of monoatomic ion transport
GO:0010959	0.482	regulation of metal ion transport
GO:0031399	0.477	regulation of protein modification process
GO:0048519	0.393	negative regulation of biological process
GO:0050896	0.366	response to stimulus
GO:0048523	0.364	negative regulation of cellular process
GO:0070372	0.363	regulation of ERK1 and ERK2 cascade
GO:0032411	0.349	positive regulation of transporter activity
GO:1904062	0.345	regulation of monoatomic cation transmembrane transport
GO:0002028	0.322	regulation of sodium ion transport
GO:0032414	0.321	positive regulation of ion transmembrane transporter activity
GO:0010765	0.302	positive regulation of sodium ion transport
GO:1904064	0.302	positive regulation of cation transmembrane transport
GO:2000649	0.301	regulation of sodium ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0005622	0.995	intracellular anatomical structure
GO:0016020	0.993	membrane
GO:0005737	0.992	cytoplasm
GO:0071944	0.991	cell periphery
GO:0005886	0.983	plasma membrane
GO:0043227	0.977	membrane-bounded organelle
GO:0043229	0.961	intracellular organelle
GO:0005576	0.933	extracellular region
GO:0043231	0.933	intracellular membrane-bounded organelle
GO:0030054	0.845	cell junction
GO:0005615	0.650	extracellular space
GO:0031982	0.582	vesicle
GO:0070062	0.469	extracellular exosome
GO:0005829	0.447	cytosol
GO:0005634	0.364	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]