StarFunc result for job id Q6PCB6

User Input

>input (329 residues)
MPEPGPRMNGFSLGELCWLFCCPPCPSRIAAKLAFLPPEPTYTVLAPEQRGAGASAPAPA
QATAAAAAAQPAPQQPEEGAGAGPGACSLHLSERADWQYSQRELDAVEVFFSRTARDNRL
GCMFVRCAPSSRYTLLFSHGNAVDLGQMCSFYIGLGSRINCNIFSYDYSGYGVSSGKPSE
KNLYADIDAAWQALRTRYGVSPENIILYGQSIGTVPTVDLASRYECAAVILHSPLMSGLR
VAFPDTRKTYCFDAFPSIDKISKVTSPVLVIHGTEDEVIDFSHGLAMYERCPRAVEPLWV
EGAGHNDIELYAQYLERLKQFISHELPNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PCB6	1.000	1.000	7.967E-73	329	1.000	1.000	Q6PCB6.pdb.gz	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
2	AFDB:Q5XIJ5	0.810	0.859	1.313E-55	310	0.726	0.771	Q5XIJ5.pdb.gz	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
3	AFDB:Q5VST6	0.811	0.924	6.093E-52	288	0.687	0.785	Q5VST6.pdb.gz	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
4	AFDB:Q9VBX8	0.801	0.919	3.611E-48	286	0.602	0.692	Q9VBX8.pdb.gz	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
5	AFDB:Q21221	0.795	0.788	1.214E-42	332	0.556	0.551	Q21221.pdb.gz	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
6	AFDB:Q8VYT1	0.738	0.888	9.444E-35	272	0.371	0.449	Q8VYT1.pdb.gz	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
7	AFDB:Q9S7U7	0.733	0.669	4.101E-34	361	0.386	0.352	Q9S7U7.pdb.gz	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
8	AFDB:Q84JV3	0.738	0.824	5.919E-34	294	0.374	0.418	Q84JV3.pdb.gz	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
9	AFDB:Q7L211	0.620	0.606	1.009E-20	337	0.195	0.190	Q7L211.pdb.gz	ABHDD_HUMAN Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 PE=2 SV=1
10	AFDB:Q8RXP6	0.617	0.655	1.096E-19	308	0.182	0.195	Q8RXP6.pdb.gz	WAV2_ARATH Alpha/beta hydrolase domain-containing protein WAV2 OS=Arabidopsis thaliana OX=3702 GN=WAV2 PE=2 SV=1
11	PDB:6eicB	0.532	0.622	3.118E-11	279	0.125	0.147	6eicB.pdb.gz
12	PDB:2ocgA	0.484	0.616	3.524E-11	254	0.109	0.142	2ocgA.pdb.gz	Molecular basis of prodrug activation by human valacyclovirase, an alpha-amino acid ester hydrolase.
13	PDB:2gbfA	0.472	0.237	1.127E-10	730	0.146	0.066	2gbfA.pdb.gz	Crystal Structures of DPP-IV (CD26) from Rat Kidney Exhibit Flexible Accommodation of Peptidase-Selective Inhibitors.
14	PDB:5xb6A	0.518	0.554	1.127E-10	306	0.152	0.163	5xb6A.pdb.gz
15	PDB:4n8eB	0.471	0.234	1.198E-10	734	0.149	0.067	4n8eB.pdb.gz	Discovery of C-(1-aryl-cyclohexyl)-methylamines as selective, orally available inhibitors of dipeptidyl peptidase IV.
16	PDB:7prmA	0.550	0.609	1.198E-10	295	0.134	0.149	7prmA.pdb.gz	Development of High Brain-Penetrant and Reversible Monoacylglycerol Lipase PET Tracers for Neuroimaging.
17	PDB:4zwnB	0.519	0.546	3.188E-10	311	0.140	0.148	4zwnB.pdb.gz
18	PDB:6y0fC	0.458	0.231	3.390E-10	722	0.143	0.065	6y0fC.pdb.gz	Structure of human FAPalpha in complex with linagliptin
19	PDB:4kryE	0.506	0.506	4.329E-10	329	0.125	0.125	4kryE.pdb.gz
20	PDB:5jzsB	0.503	0.574	5.878E-10	284	0.155	0.180	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5DFK7	0.0	634	320	0.948	0.975	AB17C_RAT Alpha/beta hydrolase domain-containing protein 17C OS=Rattus norvegicus OX=10116 GN=Abhd17c PE=1 SV=1
2	Q6PCB6	0.0	681	329	1.000	1.000	AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens OX=9606 GN=ABHD17C PE=1 SV=2
3	Q8VCV1	0.0	634	320	0.948	0.975	AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus OX=10090 GN=Abhd17c PE=1 SV=2
4	Q5XIJ5	1.15e-168	473	310	0.717	0.761	AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus OX=10116 GN=Abhd17a PE=1 SV=1
5	Q96GS6	9.48e-167	468	310	0.720	0.765	AB17A_HUMAN Alpha/beta hydrolase domain-containing protein 17A OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
6	Q5VST6	1.41e-160	451	288	0.687	0.785	AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens OX=9606 GN=ABHD17B PE=1 SV=1
7	Q6AY17	1.66e-160	451	288	0.684	0.781	AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus OX=10116 GN=Abhd17b PE=1 SV=1
8	Q7M759	1.66e-160	451	288	0.684	0.781	AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus OX=10090 GN=Abhd17b PE=1 SV=1
9	A0A4D6K2Q0	7.46e-140	401	349	0.611	0.576	A0A4D6K2Q0_DROME Uncharacterized protein, isoform H OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=1
10	Q9VBX8	1.51e-139	398	286	0.611	0.703	Q9VBX8_DROME IP15857p OS=Drosophila melanogaster OX=7227 GN=CG11935 PE=1 SV=2
11	Q21221	2.26e-119	348	332	0.544	0.539	AHO3_CAEEL Alpha/beta hydrolase domain-containing protein aho-3 OS=Caenorhabditis elegans OX=6239 GN=aho-3 PE=1 SV=2
12	Q84JV3	7.42e-73	229	294	0.380	0.425	Q84JV3_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g31020 PE=1 SV=1
13	Q9S7U7	1.20e-72	230	361	0.389	0.355	Q9S7U7_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=F28J7.1 PE=1 SV=1
14	Q8VYT1	2.24e-69	219	272	0.368	0.445	Q8VYT1_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g66900 PE=1 SV=1
15	K7EQ25	7.05e-51	170	225	0.331	0.484	K7EQ25_HUMAN Abhydrolase domain containing 17A, depalmitoylase OS=Homo sapiens OX=9606 GN=ABHD17A PE=1 SV=1
16	P9WLC7	1.00e-19	89.4	281	0.207	0.242	Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2307c PE=1 SV=1
17	Q80UX8	5.45e-17	82.8	337	0.210	0.205	ABHDD_MOUSE Protein ABHD13 OS=Mus musculus OX=10090 GN=Abhd13 PE=2 SV=1
18	P54069	1.11e-16	81.3	299	0.188	0.207	BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bem46 PE=2 SV=3
19	Q7L211	1.12e-15	79.0	337	0.210	0.205	ABHDD_HUMAN Protein ABHD13 OS=Homo sapiens OX=9606 GN=ABHD13 PE=2 SV=1
20	Q4GYA0	1.43e-15	79.7	670	0.149	0.073	Q4GYA0_TRYB2 Serine peptidase, putative serine peptidase, Clan SC, Family S9D OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4780 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	1.4e-05	36.4	alpha/beta hydrolase fold
2	PF20408 Abhydrolase_11	2e+02	13.1	Alpha/beta hydrolase domain
3	PF02230 Abhydrolase_2	36	15.6	Phospholipase/Carboxylesterase
4	PF12695 Abhydrolase_5	9.7	17.4	Alpha/beta hydrolase family
5	PF12697 Abhydrolase_6	0.00045	32.4	Alpha/beta hydrolase family
6	PF16929 Asp2	2.4e+02	12.2	Accessory Sec system GspB-transporter
7	PF20434 BD-FAE	40	15.1	BD-FAE
8	PF01738 DLH	6.5	17.8	Dienelactone hydrolase family
9	PF05677 DUF818	6.7	17.2	Chlamydia CHLPS protein (DUF818)
10	PF03959 FSH1	21	16.2	Serine hydrolase (FSH1)
11	PF12146 Hydrolase_4	4.6e-10	50.7	Serine aminopeptidase, S33
12	PF00326 Peptidase_S9	0.0089	27.1	Prolyl oligopeptidase family
13	PF05728 UPF0227	3.1	19.2	Uncharacterised protein family (UPF0227)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000258884

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358548	0.922	GTPase NRas
2	9606.ENSP00000407586	0.913	GTPase HRas
3	9606.ENSP00000256078	0.908	GTPase KRas
4	9606.ENSP00000320043	0.721	Acyl-protein thioesterase 1
5	9606.ENSP00000299192	0.592	HEAT repeat-containing protein 3
6	9606.ENSP00000363638	0.532	Acyl-protein thioesterase 2
7	9606.ENSP00000420315	0.527	Monoacylglycerol lipase ABHD6
8	9606.ENSP00000455099	0.505	Transmembrane protein 88B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008474	1.000	palmitoyl-(protein) hydrolase activity
GO:0005515	0.993	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:1901564	0.995	organonitrogen compound metabolic process
GO:0019538	0.985	protein metabolic process
GO:0065007	0.969	biological regulation
GO:0098732	0.964	macromolecule deacylation
GO:0042157	0.964	lipoprotein metabolic process
GO:0009056	0.955	catabolic process
GO:0035601	0.951	protein deacylation
GO:0050789	0.938	regulation of biological process
GO:0050794	0.914	regulation of cellular process
GO:0009057	0.860	macromolecule catabolic process
GO:0030163	0.826	protein catabolic process
GO:0009987	0.673	cellular process
GO:0048518	0.409	positive regulation of biological process
GO:0099175	0.379	regulation of postsynapse organization
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0016020	0.999	membrane
GO:0071944	0.995	cell periphery
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0005886	0.975	plasma membrane
GO:0045202	0.964	synapse
GO:0012505	0.919	endomembrane system
GO:0031090	0.822	organelle membrane
GO:0031982	0.795	vesicle
GO:0031974	0.723	membrane-enclosed lumen
GO:0070013	0.709	intracellular organelle lumen
GO:0005634	0.660	nucleus
GO:0031981	0.589	nuclear lumen
GO:0098588	0.487	bounding membrane of organelle
GO:0005654	0.465	nucleoplasm
GO:0098978	0.435	glutamatergic synapse
GO:0014069	0.402	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19233	1.000	H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]
EC:3.1.2.22	1.000	palmitoyl-protein hydrolase.

[back to server]