StarFunc result for job id Q6PCD5

User Input

>input (774 residues)
MAHEAMEYDVQVQLNHAEQQPAPAGMASSQGGPALLQPVPADVVSSQGVPSILQPAPAEV
ISSQATPPLLQPAPQLSVDLTEVEVLGEDTVENINPRTSEQHRQGSDGNHTIPASSLHSM
TNFISGLQRLHGMLEFLRPSSSNHSVGPMRTRRRVSASRRARAGGSQRTDSARLRAPLDA
YFQVSRTQPDLPATTYDSETRNPVSEELQVSSSSDSDSDSSAEYGGVVDQAEESGAVILE
EQLAGVSAEQEVTCIDGGKTLPKQPSPQKSEPLLPSASMDEEEGDTCTICLEQWTNAGDH
RLSALRCGHLFGYRCISTWLKGQVRKCPQCNKKARHSDIVVLYARTLRALDTSEQERMKS
SLLKEQMLRKQAELESAQCRLQLQVLTDKCTRLQRRVQDLQKLTSHQSQNLQQPRGSQAW
VLSCSPSSQGQHKHKYHFQKTFTVSQAGNCRIMAYCDALSCLVISQPSPQASFLPGFGVK
MLSTANMKSSQYIPMHGKQIRGLAFSSYLRGLLLSASLDNTIKLTSLETNTVVQTYNAGR
PVWSCCWCLDEANYIYAGLANGSILVYDVRNTSSHVQELVAQKARCPLVSLSYMPRAASA
AFPYGGVLAGTLEDASFWEQKMDFSHWPHVLPLEPGGCIDFQTENSSRHCLVTYRPDKNH
TTIRSVLMEMSYRLDDTGNPICSCQPVHTFFGGPTCKLLTKNAIFQSPENDGNILVCTGD
EAANSALLWDAASGSLLQDLQTDQPVLDICPFEVNRNSYLATLTEKMVHIYKWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PCD5	1.000	1.000	0.000	774	1.000	1.000	Q6PCD5.pdb.gz	RFWD3_HUMAN E3 ubiquitin-protein ligase RFWD3 OS=Homo sapiens OX=9606 GN=RFWD3 PE=1 SV=3
2	PDB:2h9lA	0.348	0.800	3.867E-14	321	0.074	0.178	2h9lA.pdb.gz
3	AFDB:O48847	0.336	0.331	5.791E-13	787	0.111	0.109	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
4	PDB:5o9zL	0.311	0.508	7.962E-13	459	0.052	0.087	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
5	PDB:5mzhB	0.322	0.567	4.090E-12	415	0.065	0.120	5mzhB.pdb.gz
6	PDB:5nnzA	0.308	0.659	4.090E-12	335	0.067	0.155	5nnzA.pdb.gz
7	PDB:3zwlD	0.329	0.683	1.344E-11	352	0.066	0.145	3zwlD.pdb.gz
8	PDB:5lj5t	0.281	0.452	1.344E-11	438	0.070	0.123	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
9	PDB:6bk8M	0.305	0.681	1.723E-11	326	0.062	0.147	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
10	PDB:5a2qg	0.335	0.774	2.561E-11	314	0.063	0.156	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
11	PDB:5yzgs	0.330	0.647	2.561E-11	374	0.065	0.134	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:7qdrC	0.334	0.793	2.828E-11	305	0.061	0.154	7qdrC.pdb.gz
13	AFDB:Q9H2Y7	0.307	0.134	7.847E-11	1883	0.141	0.058	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
14	AFDB:F4JHM9	0.284	0.131	1.423E-10	1913	0.137	0.055	F4JHM9.pdb.gz	F4JHM9_ARATH Transducin family protein / WD-40 repeat family protein OS=Arabidopsis thaliana OX=3702 GN=SETH5 PE=1 SV=1
15	AFDB:O88466	0.314	0.139	2.116E-10	1888	0.115	0.047	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
16	AFDB:O13166	0.314	0.319	2.286E-9	761	0.134	0.137	O13166.pdb.gz	TLE3A_DANRE Transducin-like enhancer protein 3-A OS=Danio rerio OX=7955 GN=tle3a PE=1 SV=1
17	AFDB:F1N9Y3	0.317	0.317	3.078E-9	773	0.120	0.120	F1N9Y3.pdb.gz
18	AFDB:Q86YC2	0.301	0.206	4.356E-9	1186	0.111	0.073	Q86YC2.pdb.gz	PALB2_HUMAN Partner and localizer of BRCA2 OS=Homo sapiens OX=9606 GN=PALB2 PE=1 SV=1
19	AFDB:Q3U0P1	0.284	0.209	7.151E-9	1104	0.137	0.096	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
20	AFDB:Q86AD8	0.245	0.167	5.616E-7	1207	0.145	0.093	Q86AD8.pdb.gz	Q86AD8_DICDI RING zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1106 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PCD5	0.0	1609	774	1.000	1.000	RFWD3_HUMAN E3 ubiquitin-protein ligase RFWD3 OS=Homo sapiens OX=9606 GN=RFWD3 PE=1 SV=3
2	Q7K2X1	3.33e-06	52.8	435	0.050	0.090	Q7K2X1_DROME GH03577p OS=Drosophila melanogaster OX=7227 GN=nopo PE=2 SV=1
3	A0A0B4KFV0	3.35e-06	52.8	434	0.050	0.090	A0A0B4KFV0_DROME No poles, isoform B OS=Drosophila melanogaster OX=7227 GN=nopo PE=4 SV=1
4	O64425	1.96e-05	49.3	249	0.048	0.149	RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana OX=3702 GN=RMA1 PE=1 SV=1
5	Q9Y7K6	3.94e-05	49.7	741	0.026	0.027	YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.04c PE=4 SV=1
6	Q6LFN2	4.31e-05	49.7	1103	0.031	0.022	ZNRF1_PLAF7 RING finger protein PFF0165c OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PFF0165c PE=1 SV=1
7	Q9SFV0	4.90e-05	47.0	182	0.067	0.286	Q9SFV0_ARATH Putative RING zinc finger protein OS=Arabidopsis thaliana OX=3702 GN=T1B9.13 PE=1 SV=1
8	Q9VI20	7.97e-05	48.5	536	0.027	0.039	GZL_DROME E3 ubiquitin-protein ligase Godzilla OS=Drosophila melanogaster OX=7227 GN=gzl PE=1 SV=1
9	O54965	8.17e-05	48.1	381	0.026	0.052	RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus OX=10090 GN=Rnf13 PE=1 SV=2
10	Q8VZ14	1.38e-04	47.4	448	0.031	0.054	RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=RMR2 PE=2 SV=1
11	O43567	2.39e-04	46.6	381	0.025	0.050	RNF13_HUMAN E3 ubiquitin-protein ligase RNF13 OS=Homo sapiens OX=9606 GN=RNF13 PE=1 SV=1
12	Q07457	3.69e-04	46.6	700	0.023	0.026	BRE1_YEAST E3 ubiquitin-protein ligase BRE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRE1 PE=1 SV=1
13	Q9XI67	4.27e-04	44.3	179	0.034	0.145	Q9XI67_ARATH At1g14200 OS=Arabidopsis thaliana OX=3702 GN=At1g14200 PE=2 SV=1
14	Q9H9V4	4.39e-04	43.9	155	0.028	0.142	RN122_HUMAN RING finger protein 122 OS=Homo sapiens OX=9606 GN=RNF122 PE=1 SV=2
15	Q6NRV0	5.48e-04	45.8	464	0.048	0.080	TRAIP_XENLA E3 ubiquitin-protein ligase TRAIP OS=Xenopus laevis OX=8355 GN=traip PE=1 SV=2
16	P87139	6.11e-04	45.4	372	0.030	0.062	YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC57A7.09 PE=1 SV=1
17	Q9LW77	8.42e-04	45.1	492	0.027	0.043	HRD1A_ARATH ERAD-associated E3 ubiquitin-protein ligase HRD1A OS=Arabidopsis thaliana OX=3702 GN=HRD1A PE=2 SV=1
18	Q7K1R6	0.001	43.5	263	0.041	0.122	Q7K1R6_DROME LD46221p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10916 PE=1 SV=1
19	Q96EQ8	0.002	42.7	232	0.035	0.116	RN125_HUMAN E3 ubiquitin-protein ligase RNF125 OS=Homo sapiens OX=9606 GN=RNF125 PE=1 SV=4
20	Q9H6Y7	0.002	43.1	350	0.023	0.051	RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens OX=9606 GN=RNF167 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	3.1e+02	13.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF07948 Nairovirus_M	1e+02	12.6	Nairovirus M polyprotein-like
3	PF20426 NBCH_WD40	4.7e+02	11.0	Neurobeachin beta propeller domain
4	PF14447 Prok-RING_4	18	16.6	Prokaryotic RING finger family 4
5	PF04641 Rtf2	28	15.6	Rtf2 RING-finger
6	PF19056 WD40_2	20	15.3	WD40 repeated domain
7	PF12861 zf-ANAPC11	2.1e+02	13.4	Anaphase-promoting complex subunit 11 RING-H2 finger
8	PF00097 zf-C3HC4	0.00032	31.8	Zinc finger, C3HC4 type (RING finger)
9	PF13923 zf-C3HC4_2	0.04	25.0	Zinc finger, C3HC4 type (RING finger)
10	PF13920 zf-C3HC4_3	0.079	24.1	Zinc finger, C3HC4 type (RING finger)
11	PF15227 zf-C3HC4_4	32	16.1	zinc finger of C3HC4-type, RING
12	PF11789 zf-Nse	3.9e+02	12.4	Zinc-finger of the MIZ type in Nse subunit
13	PF12678 zf-rbx1	0.75	21.4	RING-H2 zinc finger domain
14	PF17123 zf-RING_11	0.66	21.1	RING-like zinc finger
15	PF13639 zf-RING_2	1.9e-05	36.2	Ring finger domain
16	PF14634 zf-RING_5	7	18.0	zinc-RING finger domain
17	PF13445 zf-RING_UBOX	0.022	26.1	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354361

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.971	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000363017	0.946	Replication protein A 32 kDa subunit
3	9606.ENSP00000254719	0.935	Replication protein A 70 kDa DNA-binding subunit
4	9606.ENSP00000223129	0.868	Replication protein A 14 kDa subunit
5	9606.ENSP00000385334	0.814	Mitotic spindle assembly checkpoint protein MAD1
6	9606.ENSP00000240361	0.807	Inactive serine/threonine-protein kinase TEX14
7	9606.ENSP00000298139	0.781	Werner syndrome ATP-dependent helicase
8	9606.ENSP00000440440	0.749	Activating transcription factor 7-interacting protein 1
9	9606.ENSP00000380820	0.669	Germinal-center associated nuclear protein
10	9606.ENSP00000336701	0.643	DNA repair protein RAD51 homolog 3
11	9606.ENSP00000372088	0.640	DNA repair protein RAD51 homolog 1
12	9606.ENSP00000349823	0.625	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1
13	9606.ENSP00000310842	0.620	Fanconi anemia group I protein
14	9606.ENSP00000405674	0.614	Nucleolar protein 7
15	9606.ENSP00000450607	0.593	Protein timeless homolog
16	9606.ENSP00000364119	0.587	Eukaryotic translation initiation factor 2 subunit 2
17	9606.ENSP00000287647	0.583	Fanconi anemia group D2 protein
18	9606.ENSP00000373952	0.568	Fanconi anemia group A protein
19	9606.ENSP00000356243	0.556	Ubiquitin-conjugating enzyme E2 T
20	9606.ENSP00000224950	0.549	CST complex subunit STN1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0097159	0.368	organic cyclic compound binding
GO:1901363	0.367	heterocyclic compound binding
GO:0097371	0.351	MDM2/MDM4 family protein binding
GO:0003676	0.339	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006310	0.989	DNA recombination
GO:0006302	0.989	double-strand break repair
GO:0044773	0.988	mitotic DNA damage checkpoint signaling
GO:1901990	0.987	regulation of mitotic cell cycle phase transition
GO:0045005	0.987	DNA-templated DNA replication maintenance of fidelity
GO:1902807	0.986	negative regulation of cell cycle G1/S phase transition
GO:2001020	0.984	regulation of response to DNA damage stimulus
GO:0032446	0.984	protein modification by small protein conjugation
GO:0031297	0.983	replication fork processing
GO:0000724	0.982	double-strand break repair via homologous recombination
GO:0009314	0.981	response to radiation
GO:0036297	0.980	interstrand cross-link repair
GO:1901976	0.976	regulation of cell cycle checkpoint
GO:0044819	0.976	mitotic G1/S transition checkpoint signaling
GO:0016567	0.974	protein ubiquitination
GO:0010212	0.880	response to ionizing radiation
GO:0031571	0.498	mitotic G1 DNA damage checkpoint signaling
GO:0048518	0.352	positive regulation of biological process
GO:0019222	0.330	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005694	0.999	chromosome
GO:0090734	0.982	site of DNA damage
GO:0035861	0.965	site of double-strand break
GO:0032991	0.959	protein-containing complex
GO:0005737	0.548	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]