StarFunc result for job id Q6PD62

User Input

>input (1173 residues)
MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEF
VKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMA
DKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYR
GALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAV
LELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTE
VEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENA
SQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQ
ILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR
AKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAM
ARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSD
TYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHK
GYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVV
LYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVL
NAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERE
LRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKE
KKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKR
RRHPKGEEGSDDDETENGPKPKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDS
SDEDKLKIADEGHPRNSNSNSDSDEDEQRKKCASSESDSDENQNKSGSEAGSPRRPRRQR
SDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSENDSRPASPSAESDHESERGSDN
EGSGQGSGNESEPEGSNNEASDRGSEHGSDDSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A3KDM3	0.738	0.746	0.000	1160	0.850	0.859	A3KDM3.pdb.gz	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
2	AFDB:Q62018	0.775	0.775	0.000	1173	0.977	0.977	Q62018.pdb.gz	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
3	AFDB:Q7K0X3	0.729	0.743	3.182E-89	1150	0.574	0.585	Q7K0X3.pdb.gz	Q7K0X3_DROME Ctr9, isoform A OS=Drosophila melanogaster OX=7227 GN=Ctr9 PE=1 SV=1
4	PDB:6tedQ	0.700	0.909	3.091E-80	890	0.759	1.000	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
5	PDB:7dkhI	0.522	0.647	2.145E-33	914	0.169	0.217	7dkhI.pdb.gz
6	PDB:4bujB	0.381	0.341	2.496E-17	1367	0.107	0.092	4bujB.pdb.gz
7	PDB:7qdrB	0.261	0.256	3.057E-17	1212	0.118	0.114	7qdrB.pdb.gz
8	PDB:7ntfA	0.204	0.251	7.079E-14	918	0.078	0.099	7ntfA.pdb.gz
9	PDB:6c95A	0.200	0.274	1.438E-11	773	0.087	0.132	6c95A.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
10	PDB:6bq1B	0.229	0.331	2.751E-11	728	0.098	0.158	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
11	PDB:7qe7J	0.230	0.479	2.984E-11	510	0.078	0.180	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:6yj6A	0.130	0.172	5.265E-11	819	0.092	0.132	6yj6A.pdb.gz
13	PDB:7qe7K	0.226	0.450	7.284E-11	531	0.062	0.137	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	AFDB:A0A0G2K8V3	0.088	0.077	3.144E-9	1613	0.138	0.100	A0A0G2K8V3.pdb.gz	A0A0G2K8V3_RAT THO complex subunit 2 OS=Rattus norvegicus OX=10116 GN=Thoc2 PE=1 SV=2
15	AFDB:Q1JU68	0.101	0.091	1.354E-8	1354	0.155	0.134	Q1JU68.pdb.gz	EIF3A_RAT Eukaryotic translation initiation factor 3 subunit A OS=Rattus norvegicus OX=10116 GN=Eif3a PE=2 SV=2
16	AFDB:Q6PR54	0.122	0.087	3.306E-8	2419	0.123	0.060	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
17	AFDB:Q5UIP0	0.115	0.087	4.391E-8	2472	0.132	0.063	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
18	AFDB:E1C2U2	0.117	0.079	1.608E-7	2326	0.125	0.063	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
19	AFDB:P59764	0.129	0.093	1.691E-6	1978	0.142	0.084	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
20	AFDB:Q6TRW4	0.114	0.104	2.750E-6	1447	0.149	0.121	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A3KDM3	0.0	1941	1160	0.855	0.865	A3KDM3_DANRE CTR9 homolog, Paf1/RNA polymerase II complex component OS=Danio rerio OX=7955 GN=fc54a06 PE=1 SV=1
2	Q62018	0.0	2368	1173	0.977	0.977	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
3	Q6PD62	0.0	2433	1173	1.000	1.000	CTR9_HUMAN RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1
4	Q7K0X3	0.0	1265	1150	0.512	0.523	Q7K0X3_DROME Ctr9, isoform A OS=Drosophila melanogaster OX=7227 GN=Ctr9 PE=1 SV=1
5	B5X0I6	2.83e-171	536	1091	0.285	0.306	VIP6_ARATH Protein CTR9 homolog OS=Arabidopsis thaliana OX=3702 GN=VIP6 PE=1 SV=1
6	O42668	1.38e-63	238	1039	0.235	0.266	TPR1_SCHPO Tetratricopeptide repeat protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tpr1 PE=1 SV=1
7	P89105	4.49e-47	186	1077	0.210	0.228	CTR9_YEAST RNA polymerase-associated protein CTR9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTR9 PE=1 SV=3
8	Q57V64	3.67e-23	108	901	0.131	0.171	Q57V64_TRYB2 RNA polymerase-associated protein CTR9 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.3K10.260 PE=4 SV=1
9	Q9M8Y0	2.40e-11	70.9	977	0.081	0.097	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
10	Q5ADP3	5.67e-10	66.2	1080	0.072	0.078	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
11	A0A0R4IVJ0	1.82e-09	64.7	1102	0.070	0.074	A0A0R4IVJ0_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=ogt.2 PE=1 SV=1
12	Q5GA11	5.22e-09	63.2	1046	0.080	0.090	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
13	Q8CGY8	5.63e-09	63.2	1046	0.080	0.090	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
14	O15294	5.68e-09	63.2	1046	0.080	0.090	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
15	P56558	5.71e-09	63.2	1036	0.080	0.091	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
16	P81436	5.88e-09	63.2	1046	0.080	0.090	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
17	P14922	5.92e-09	62.8	966	0.068	0.083	CYC8_YEAST General transcriptional corepressor CYC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYC8 PE=1 SV=2
18	Q5GA13	6.43e-09	62.8	1062	0.080	0.089	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
19	Q5GA10	7.00e-09	62.8	1036	0.080	0.091	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
20	Q5GA12	7.72e-09	62.8	1052	0.080	0.089	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.0077	27.8	Anaphase-promoting complex, cyclosome, subunit 3
2	PF20225 DUF6584	32	15.9	Family of unknown function (DUF6584)
3	PF16918 PknG_TPR	0.97	19.8	Protein kinase G tetratricopeptide repeat
4	PF00515 TPR_1	5.4e-38	138.5	Tetratricopeptide repeat
5	PF13374 TPR_10	1.1e-12	58.6	Tetratricopeptide repeat
6	PF13414 TPR_11	1.8e-10	51.7	TPR repeat
7	PF13424 TPR_12	4.8e-22	89.4	Tetratricopeptide repeat
8	PF13428 TPR_14	1.2e-25	98.9	Tetratricopeptide repeat
9	PF13432 TPR_16	3.4e-26	102.8	Tetratricopeptide repeat
10	PF13431 TPR_17	4.4e-13	59.7	Tetratricopeptide repeat
11	PF14559 TPR_19	3.3e-32	122.1	Tetratricopeptide repeat
12	PF07719 TPR_2	1.6e-34	126.2	Tetratricopeptide repeat
13	PF13174 TPR_6	2.3e-09	48.4	Tetratricopeptide repeat
14	PF13176 TPR_7	2.2e-07	41.5	Tetratricopeptide repeat
15	PF13181 TPR_8	1e-28	108.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221265	0.999	RNA polymerase II-associated factor 1 homolog
2	9606.ENSP00000267973	0.999	WD repeat-containing protein 61
3	9606.ENSP00000299601	0.999	RNA polymerase-associated protein LEO1
4	9606.ENSP00000356405	0.999	Parafibromin
5	9606.ENSP00000374280	0.999	RNA polymerase-associated protein RTF1 homolog
6	9606.ENSP00000470252	0.998	Transcription elongation factor SPT5
7	9606.ENSP00000216297	0.997	FACT complex subunit SPT16
8	9606.ENSP00000480158	0.997	DNA-directed RNA polymerase II subunit RPB1
9	9606.ENSP00000319104	0.993	Transcription elongation factor SPT6
10	9606.ENSP00000278412	0.990	FACT complex subunit SSRP1
11	9606.ENSP00000225504	0.981	Transcription elongation factor SPT4
12	9606.ENSP00000219252	0.971	DNA-directed RNA polymerase II subunit RPB3
13	9606.ENSP00000370625	0.962	DNA-directed RNA polymerase II subunit RPB2
14	9606.ENSP00000373772	0.958	E3 ubiquitin-protein ligase BRE1A
15	9606.ENSP00000272645	0.957	DNA-directed RNA polymerase II subunit RPB4
16	9606.ENSP00000295321	0.956	Protein IWS1 homolog
17	9606.ENSP00000301788	0.944	DNA-directed RNA polymerase II subunit RPB7
18	9606.ENSP00000403852	0.940	DNA-directed RNA polymerases I, II, and III subunit RPABC2
19	9606.ENSP00000292614	0.937	DNA-directed RNA polymerase II subunit RPB11-a
20	9606.ENSP00000221859	0.934	DNA-directed RNA polymerase II subunit RPB9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042169	0.566	SH2 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.990	primary metabolic process
GO:0006807	0.989	nitrogen compound metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0060255	0.988	regulation of macromolecule metabolic process
GO:0043170	0.987	macromolecule metabolic process
GO:0050794	0.985	regulation of cellular process
GO:0080090	0.982	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0036211	0.974	protein modification process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0048519	0.958	negative regulation of biological process
GO:0044260	0.956	cellular macromolecule metabolic process
GO:0032501	0.926	multicellular organismal process
GO:0032502	0.923	developmental process
GO:0016570	0.896	histone modification
GO:0032259	0.862	methylation
GO:0008213	0.859	protein alkylation
GO:0051246	0.817	regulation of protein metabolic process
GO:0018205	0.816	peptidyl-lysine modification
GO:0043414	0.815	macromolecule methylation
GO:0006479	0.811	protein methylation
GO:0018022	0.799	peptidyl-lysine methylation
GO:0031056	0.797	regulation of histone modification
GO:0009790	0.791	embryo development
GO:0009888	0.784	tissue development
GO:0048523	0.754	negative regulation of cellular process
GO:0018023	0.753	peptidyl-lysine trimethylation
GO:0019219	0.685	regulation of nucleobase-containing compound metabolic process
GO:0031325	0.680	positive regulation of cellular metabolic process
GO:0051173	0.674	positive regulation of nitrogen compound metabolic process
GO:0010604	0.674	positive regulation of macromolecule metabolic process
GO:0009653	0.635	anatomical structure morphogenesis
GO:0031060	0.620	regulation of histone methylation
GO:0034641	0.606	cellular nitrogen compound metabolic process
GO:0009792	0.589	embryo development ending in birth or egg hatching
GO:0043009	0.579	chordate embryonic development
GO:0030154	0.577	cell differentiation
GO:0010468	0.576	regulation of gene expression
GO:0090304	0.559	nucleic acid metabolic process
GO:0048646	0.524	anatomical structure formation involved in morphogenesis
GO:0016571	0.495	histone methylation
GO:0048513	0.494	animal organ development
GO:0051252	0.481	regulation of RNA metabolic process
GO:0009889	0.468	regulation of biosynthetic process
GO:0010556	0.464	regulation of macromolecule biosynthetic process
GO:0031326	0.464	regulation of cellular biosynthetic process
GO:0010467	0.461	gene expression
GO:0016070	0.460	RNA metabolic process
GO:0006355	0.441	regulation of DNA-templated transcription
GO:0034968	0.440	histone lysine methylation
GO:0051568	0.419	histone H3-K4 methylation
GO:0006366	0.416	transcription by RNA polymerase II
GO:0043473	0.351	pigmentation
GO:0050896	0.337	response to stimulus
GO:0051247	0.321	positive regulation of protein metabolic process
GO:0006357	0.320	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016593	0.999	Cdc73/Paf1 complex
GO:0043232	0.732	intracellular non-membrane-bounded organelle
GO:0005737	0.468	cytoplasm
GO:0005694	0.386	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]