StarFunc result for job id Q6PEW1

User Input

>input (402 residues)
MASIIARVGNSRRLNAPLPPWAHSMLRSLGRSLGPIMASMADRNMKLFSGRVVPAQGEET
FENWLTQVNGVLPDWNMSEEEKLKRLMKTLRGPAREVMRVLQATNPNLSVADFLRAMKLV
FGESESSVTAHGKFFNTLQAQGEKASLYVIRLEVQLQNAIQAGIIAEKDANRTRLQQLLL
GGELSRDLRLRLKDFLRMYANEQERLPNFLELIRMVREEEDWDDAFIKRKRPKRSESMVE
RAVSPVAFQGSPPIVIGSADCNVIEIDDTLDDSDEDVILVESQDPPLPSWGAPPLRDRAR
PQDEVLVIDSPHNSRAQFPSTSGGSGYKNNGPGEMRRARKRKHTIRCSYCGEEGHSKETC
DNESDKAQVFENLIITLQELTHTEMERSRVAPGEYNDFSEPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PEW1	1.000	1.000	6.664E-56	402	1.000	1.000	Q6PEW1.pdb.gz	ZCH12_HUMAN Zinc finger CCHC domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZCCHC12 PE=1 SV=2
2	AFDB:Q9CZA5	0.534	0.534	6.279E-41	402	0.746	0.746	Q9CZA5.pdb.gz	ZCH12_MOUSE Zinc finger CCHC domain-containing protein 12 OS=Mus musculus OX=10090 GN=Zcchc12 PE=1 SV=1
3	AFDB:Q9UL41	0.431	0.378	3.249E-16	463	0.254	0.220	Q9UL41.pdb.gz	PNMA3_HUMAN Paraneoplastic antigen Ma3 OS=Homo sapiens OX=9606 GN=PNMA3 PE=1 SV=3
4	AFDB:Q96PV4	0.393	0.358	4.453E-15	448	0.239	0.214	Q96PV4.pdb.gz	PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens OX=9606 GN=PNMA5 PE=1 SV=2
5	AFDB:Q8ND90	0.419	0.472	1.690E-14	353	0.209	0.238	Q8ND90.pdb.gz	PNMA1_HUMAN Paraneoplastic antigen Ma1 OS=Homo sapiens OX=9606 GN=PNMA1 PE=1 SV=2
6	AFDB:Q9UL42	0.428	0.469	3.725E-14	364	0.206	0.228	Q9UL42.pdb.gz	PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2
7	AFDB:Q9ERH6	0.377	0.422	1.756E-12	352	0.162	0.185	Q9ERH6.pdb.gz	MOAP1_MOUSE Modulator of apoptosis 1 OS=Mus musculus OX=10090 GN=Moap1 PE=1 SV=1
8	AFDB:Q96BY2	0.395	0.446	2.362E-12	351	0.164	0.188	Q96BY2.pdb.gz	MOAP1_HUMAN Modulator of apoptosis 1 OS=Homo sapiens OX=9606 GN=MOAP1 PE=1 SV=1
9	PDB:7r24A	0.160	0.370	9.344E-3	150	0.077	0.207	7r24A.pdb.gz
10	AFDB:P05067	0.100	0.059	2.125E-2	770	0.119	0.062	P05067.pdb.gz	A4_HUMAN Amyloid-beta precursor protein OS=Homo sapiens OX=9606 GN=APP PE=1 SV=3
11	AFDB:F4I313	0.130	0.069	3.659E-2	913	0.095	0.042	F4I313.pdb.gz	SCY2A_ARATH SCY1-like protein 2 A OS=Arabidopsis thaliana OX=3702 GN=SCYL2A PE=1 SV=1
12	PDB:6taqA	0.240	0.509	8.212E-2	164	0.067	0.165	6taqA.pdb.gz
13	PDB:1keyB	0.083	0.136	8.370E-1	221	0.075	0.136	1keyB.pdb.gz
14	PDB:1sxjE	0.147	0.177	1.845	317	0.067	0.085	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
15	PDB:6o6pA	0.081	0.130	1.845	188	0.080	0.170	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.
16	PDB:5aanA	0.091	0.154	1.938	183	0.065	0.142	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
17	PDB:7enav	0.097	0.207	1.938	134	0.057	0.172	7enav.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
18	PDB:4bszB	0.106	0.205	2.037	150	0.050	0.133	4bszB.pdb.gz
19	PDB:5lhdC	0.106	0.061	2.037	905	0.087	0.039	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
20	PDB:1x8zA	0.071	0.146	2.140	151	0.040	0.106	1x8zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PEW1	0.0	828	402	1.000	1.000	ZCH12_HUMAN Zinc finger CCHC domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZCCHC12 PE=1 SV=2
2	Q9CZA5	0.0	562	402	0.746	0.746	ZCH12_MOUSE Zinc finger CCHC domain-containing protein 12 OS=Mus musculus OX=10090 GN=Zcchc12 PE=1 SV=1
3	Q8ND90	1.90e-38	143	353	0.192	0.218	PNMA1_HUMAN Paraneoplastic antigen Ma1 OS=Homo sapiens OX=9606 GN=PNMA1 PE=1 SV=2
4	Q96PV4	2.06e-38	145	448	0.197	0.176	PNMA5_HUMAN Paraneoplastic antigen-like protein 5 OS=Homo sapiens OX=9606 GN=PNMA5 PE=1 SV=2
5	Q8VHZ4	3.12e-38	142	353	0.211	0.241	PNMA1_RAT Paraneoplastic antigen Ma1 homolog OS=Rattus norvegicus OX=10116 GN=Pnma1 PE=2 SV=1
6	Q9UL41	6.82e-37	141	463	0.266	0.231	PNMA3_HUMAN Paraneoplastic antigen Ma3 OS=Homo sapiens OX=9606 GN=PNMA3 PE=1 SV=3
7	Q9UL42	7.53e-37	139	364	0.187	0.206	PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2
8	Q9ERH6	3.03e-30	121	352	0.164	0.188	MOAP1_MOUSE Modulator of apoptosis 1 OS=Mus musculus OX=10090 GN=Moap1 PE=1 SV=1
9	P0CW24	3.12e-27	114	399	0.199	0.201	PNM6A_HUMAN Paraneoplastic antigen-like protein 6A OS=Homo sapiens OX=9606 GN=PNMA6A PE=1 SV=2
10	Q96BY2	6.53e-27	112	351	0.162	0.185	MOAP1_HUMAN Modulator of apoptosis 1 OS=Homo sapiens OX=9606 GN=MOAP1 PE=1 SV=1
11	Q9FKF9	1.1	33.5	317	0.030	0.038	M5162_ARATH Probable transcription factor At5g61620 OS=Arabidopsis thaliana OX=3702 GN=At5g61620 PE=3 SV=1
12	Q925H1	2.6	32.7	1281	0.070	0.022	TRPS1_MOUSE Zinc finger transcription factor Trps1 OS=Mus musculus OX=10090 GN=Trps1 PE=1 SV=1
13	Q7KTX7	2.7	32.7	482	0.085	0.071	PRKN_DROME E3 ubiquitin-protein ligase parkin OS=Drosophila melanogaster OX=7227 GN=park PE=1 SV=1
14	Q99IB8	3.7	32.3	3033	0.062	0.008	POLG_HCVJF Genome polyprotein OS=Hepatitis C virus genotype 2a (isolate JFH-1) OX=356411 PE=1 SV=3
15	O65639	6.3	31.2	299	0.062	0.084	CSP1_ARATH Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1
16	Q7XC57	9.2	30.8	318	0.027	0.035	MYBS3_ORYSJ Transcription factor MYBS3 OS=Oryza sativa subsp. japonica OX=39947 GN=MYBS3 PE=2 SV=1
17	Q38DE2	9.6	30.8	390	0.047	0.049	Q38DE2_TRYB2 CCHC-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3670 PE=1 SV=1
18	Q79791	9.8	30.8	500	0.025	0.020	Q79791_9HIV1 Gag polyprotein OS=Human immunodeficiency virus 1 OX=11676 GN=gag PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17388 GP24_25	1.3e+02	14.4	Mycobacteriophage tail assembly protein
2	PF14893 PNMA	8e-38	142.3	PNMA
3	PF16588 zf-C2H2_10	21	16.2	C2H2 zinc-finger
4	PF00098 zf-CCHC	3.3e+02	12.8	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000308921

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262158	0.692	Mothers against decapentaplegic homolog 7
2	9606.ENSP00000376077	0.677	Small ubiquitin-related modifier 1
3	9606.ENSP00000315383	0.647	Retroviral-like aspartic protease 1
4	9606.ENSP00000318131	0.622	Paraneoplastic antigen-like protein 8A
5	9606.ENSP00000426568	0.615	Mothers against decapentaplegic homolog 1
6	9606.ENSP00000230538	0.586	Laminin subunit alpha-4
7	9606.ENSP00000324532	0.581	Laminin subunit alpha-3
8	9606.ENSP00000419786	0.569	Retrotransposon Gag-like protein 9
9	9606.ENSP00000318914	0.514	Paraneoplastic Ma antigens
10	9606.ENSP00000476792	0.513	Retrotransposon Gag-like protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.992	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0070848	0.976	response to growth factor
GO:0007167	0.975	enzyme-linked receptor protein signaling pathway
GO:0019219	0.968	regulation of nucleobase-containing compound metabolic process
GO:0007178	0.957	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010468	0.946	regulation of gene expression
GO:0010556	0.941	regulation of macromolecule biosynthetic process
GO:0031326	0.929	regulation of cellular biosynthetic process
GO:0009893	0.925	positive regulation of metabolic process
GO:0031325	0.919	positive regulation of cellular metabolic process
GO:0071495	0.917	cellular response to endogenous stimulus
GO:0051252	0.910	regulation of RNA metabolic process
GO:0071772	0.843	response to BMP
GO:0071363	0.843	cellular response to growth factor stimulus
GO:0051173	0.581	positive regulation of nitrogen compound metabolic process
GO:0006355	0.567	regulation of DNA-templated transcription
GO:0031328	0.566	positive regulation of cellular biosynthetic process
GO:0010604	0.562	positive regulation of macromolecule metabolic process
GO:0071773	0.468	cellular response to BMP stimulus
GO:0006357	0.457	regulation of transcription by RNA polymerase II
GO:0030509	0.448	BMP signaling pathway
GO:0010557	0.443	positive regulation of macromolecule biosynthetic process
GO:0045935	0.443	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.409	positive regulation of RNA metabolic process
GO:0045893	0.396	positive regulation of DNA-templated transcription
GO:0045944	0.367	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016604	0.990	nuclear body
GO:0016607	0.972	nuclear speck
GO:0016605	0.971	PML body
GO:0005737	0.937	cytoplasm
GO:0016020	0.899	membrane
GO:0005829	0.407	cytosol
GO:0043232	0.310	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]