StarFunc result for job id Q6PFW1

User Input

>input (1433 residues)
MWSLTASEGESTTAHFFLGAGDEGLGTRGIGMRPEESDSELLEDEEDEVPPEPQIIVGIC
AMTKKSKSKPMTQILERLCRFDYLTVVILGEDVILNEPVENWPSCHCLISFHSKGFPLDK
AVAYSKLRNPFLINDLAMQYYIQDRREVYRILQEEGIDLPRYAVLNRDPARPEECNLIEG
EDQVEVNGAVFPKPFVEKPVSAEDHNVYIYYPSSAGGGSQRLFRKIGSRSSVYSPESSVR
KTGSYIYEEFMPTDGTDVKVYTVGPDYAHAEARKSPALDGKVERDSEGKEIRYPVMLTAM
EKLVARKVCVAFKQTVCGFDLLRANGHSFVCDVNGFSFVKNSMKYYDDCAKILGNTIMRE
LAPQFQIPWSIPTEAEDIPIVPTTSGTMMELRCVIAIIRHGDRTPKQKMKMEVKHPRFFA
LFEKHGGYKTGKLKLKRPEQLQEVLDITRLLLAELEKEPGGEIEEKTGKLEQLKSVLEMY
GHFSGINRKVQLTYYPHGVKASNEGQDPQRETLAPSLLLVLKWGGELTPAGRVQAEELGR
AFRCMYPGGQGDYAGFPGCGLLRLHSTFRHDLKIYASDEGRVQMTAAAFAKGLLALEGEL
TPILVQMVKSANMNGLLDSDGDSLSSCQHRVKARLHHILQQDAPFGPEDYDQLAPTRSTS
LLNSMTIIQNPVKVCDQVFALIENLTHQIRERMQDPRSVDLQLYHSETLELMLQRWSKLE
RDFRQKSGRYDISKIPDIYDCVKYDVQHNGSLGLQGTAELLRLSKALADVVIPQEYGISR
EEKLEIAVGFCLPLLRKILLDLQRTHEDESVNKLHPLCYLRYSRGVLSPGRHVRTRLYFT
SESHVHSLLSVFRYGGLLDETQDAQWQRALDYLSAISELNYMTQIVIMLYEDNTQDPLSE
ERFHVELHFSPGVKGVEEEGSAPAGCGFRPASSENEEMKTNQGSMENLCPGKASDEPDRA
LQTSPQPPEGPGLPRRSPLIRNRKAGSMEVLSETSSSRPGGYRLFSSSRPPTEMKQSGLG
SQCTGLFSTTVLGGSSSAPNLQDYARSHGKKLPPASLKHRDELLFVPAVKRFSVSFAKHP
TNGFEGCSMVPTIYPLETLHNALSLRQVSEFLSRVCQRHTDAQAQASAALFDSMHSSQAS
DNPFSPPRTLHSPPLQLQQRSEKPPWYSSGPSSTVSSAGPSSPTTVDGNSQFGFSDQPSL
NSHVAEEHQGLGLLQETPGSGAQELSIEGEQELFEPNQSPQVPPMETSQPYEEVSQPCQE
VPDISQPCQDISEALSQPCQKVPDISQQCQENHDNGNHTCQEVPHISQPCQKSSQLCQKV
SEEVCQLCLENSEEVSQPCQGVSVEVGKLVHKFHVGVGSLVQETLVEVGSPAEEIPEEVI
QPYQEFSVEVGRLAQETSAINLLSQGIPEIDKPSQEFPEEIDLQAQEVPEEIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C644	0.671	0.670	0.000	1434	0.896	0.895	P0C644.pdb.gz	VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ppip5k1 PE=1 SV=1
2	AFDB:Q6PFW1	0.999	0.999	0.000	1433	1.000	1.000	Q6PFW1.pdb.gz	VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
3	AFDB:Q6ZQB6	0.640	0.810	0.000	1129	0.544	0.690	Q6ZQB6.pdb.gz	VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ppip5k2 PE=1 SV=3
4	AFDB:Q84WW3	0.367	0.480	2.555E-81	1049	0.302	0.413	Q84WW3.pdb.gz	VIP2L_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2 OS=Arabidopsis thaliana OX=3702 GN=VIP2 PE=1 SV=1
5	PDB:4iwxA	0.159	0.685	5.200E-11	294	0.037	0.180	4iwxA.pdb.gz	Structure and function of Escherichia coli RimK, an ATP-grasp fold, l-glutamyl ligase enzyme.
6	PDB:3vpbB	0.141	0.597	1.144E-9	282	0.029	0.145	3vpbB.pdb.gz	Lysine and arginine biosyntheses mediated by a common carrier protein in Sulfolobus
7	PDB:7tn8A	0.159	0.702	4.215E-9	281	0.038	0.196	7tn8A.pdb.gz	Structural and catalytic analyses of the InsP 6 kinase activities of higher plant ITPKs.
8	PDB:4fu0A	0.144	0.494	1.125E-7	343	0.035	0.146	4fu0A.pdb.gz	Structural and functional characterization of VanG D-Ala:D-Ser ligase associated with vancomycin resistance in Enterococcus faecalis
9	PDB:6jilB	0.146	0.586	1.577E-7	298	0.033	0.158	6jilB.pdb.gz	Cyclization mechanism catalyzed by an ATP-grasp enzyme essential for d-cycloserine biosynthesis.
10	PDB:1e4eA	0.148	0.494	2.955E-7	341	0.034	0.144	1e4eA.pdb.gz	The molecular basis of vancomycin resistance in clinically relevant Enterococci: crystal structure of D-alanyl-D-lactate ligase (VanA).
11	PDB:3lwbA	0.148	0.550	5.536E-7	323	0.030	0.133	3lwbA.pdb.gz
12	PDB:4c5aA	0.155	0.563	1.142E-6	306	0.029	0.134	4c5aA.pdb.gz	Inhibition of D-Ala:D-Ala ligase through a phosphorylated form of the antibiotic D-cycloserine.
13	PDB:3lwbB	0.143	0.586	4.417E-6	298	0.031	0.151	3lwbB.pdb.gz
14	PDB:1nt4A	0.143	0.452	5.106E-6	391	0.046	0.169	1nt4A.pdb.gz	Functional insights revealed by the crystal structures of Escherichia coli glucose-1-phosphatase.
15	AFDB:Q961B0	0.051	0.061	1.730E-1	1067	0.091	0.122	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
16	AFDB:E7EX17	0.037	0.067	2.672E-1	616	0.050	0.117	E7EX17.pdb.gz	E7EX17_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=1
17	AFDB:Q9VAS9	0.046	0.034	3.746E-1	2417	0.098	0.058	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
18	AFDB:Q7Z2Z1	0.050	0.043	3.932E-1	1910	0.124	0.093	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
19	AFDB:Q1LVF3	0.052	0.060	7.019E-1	1180	0.103	0.125	Q1LVF3.pdb.gz	SMG7_DANRE Nonsense-mediated mRNA decay factor SMG7 OS=Danio rerio OX=7955 GN=smg7 PE=2 SV=2
20	AFDB:P11831	0.030	0.066	7.366E-1	508	0.057	0.159	P11831.pdb.gz	SRF_HUMAN Serum response factor OS=Homo sapiens OX=9606 GN=SRF PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7WPL9	0.0	2943	1429	0.997	1.000	B7WPL9_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
2	F4J8C6	0.0	727	1050	0.305	0.416	VIP1L_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP1 OS=Arabidopsis thaliana OX=3702 GN=VIP1 PE=1 SV=1
3	F4J8C7	0.0	723	1056	0.306	0.415	F4J8C7_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Arabidopsis thaliana OX=3702 GN=ATVIP1 PE=1 SV=1
4	F8W9A8	0.0	2893	1409	0.983	1.000	F8W9A8_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
5	O43314	0.0	1585	1243	0.570	0.657	VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2 PE=1 SV=3
6	P0C644	0.0	2518	1434	0.897	0.897	VIP1_RAT Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Rattus norvegicus OX=10116 GN=Ppip5k1 PE=1 SV=1
7	P91309	0.0	961	1323	0.345	0.374	VIP1_CAEEL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Caenorhabditis elegans OX=6239 GN=F46F11.1 PE=3 SV=3
8	Q6PFW1	0.0	2958	1433	1.000	1.000	VIP1_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 1 OS=Homo sapiens OX=9606 GN=PPIP5K1 PE=1 SV=1
9	Q6ZQB6	0.0	1466	1129	0.508	0.645	VIP2_MOUSE Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Mus musculus OX=10090 GN=Ppip5k2 PE=1 SV=3
10	Q84WW3	0.0	731	1049	0.306	0.418	VIP2L_ARATH Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase VIP2 OS=Arabidopsis thaliana OX=3702 GN=VIP2 PE=1 SV=1
11	O74429	6.65e-133	436	920	0.220	0.342	VIP1_SCHPO Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asp1 PE=1 SV=1
12	Q06685	7.95e-116	394	1146	0.186	0.233	VIP1_YEAST Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VIP1 PE=1 SV=1
13	Q54PE2	9.84e-73	253	484	0.095	0.281	Q54PE2_DICDI Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284617 PE=3 SV=1
14	A0A1D8PMU9	3.68e-54	205	735	0.120	0.234	A0A1D8PMU9_CANAL Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VIP1 PE=3 SV=1
15	Q9UW13	0.077	40.0	622	0.029	0.068	PALF_CANAL pH-response regulator protein palF/RIM8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIM8 PE=2 SV=2
16	P40062	1.2	33.5	109	0.013	0.165	YES7_YEAST Putative uncharacterized protein YER097W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YER097W PE=5 SV=1
17	Q9Y128	1.8	35.4	601	0.015	0.037	Q9Y128_DROME Ceramide transfer protein OS=Drosophila melanogaster OX=7227 GN=cert PE=1 SV=1
18	Q8RY25	3.9	34.7	1041	0.022	0.030	NU98A_ARATH Nuclear pore complex protein NUP98A OS=Arabidopsis thaliana OX=3702 GN=NUP98A PE=1 SV=1
19	Q9D7G4	4.1	33.9	290	0.024	0.117	EURL_MOUSE Protein EURL homolog OS=Mus musculus OX=10090 GN=Eurl PE=1 SV=1
20	Q14BI7	5.4	33.9	1383	0.017	0.018	TDRD9_MOUSE ATP-dependent RNA helicase TDRD9 OS=Mus musculus OX=10090 GN=Tdrd9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00328 His_Phos_2	8.9e-132	451.7	Histidine phosphatase superfamily (branch 2)
2	PF18086 PPIP5K2_N	9.5e-37	136.4	Diphosphoinositol pentakisphosphate kinase 2 N-terminal domain
3	PF08443 RimK	1.4e+02	13.5	RimK-like ATP-grasp domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482032	0.991	Inositol hexakisphosphate kinase 1
2	9606.ENSP00000331103	0.987	Inositol hexakisphosphate kinase 2
3	9606.ENSP00000398861	0.985	Inositol hexakisphosphate kinase 3
4	9606.ENSP00000287996	0.981	Inositol-pentakisphosphate 2-kinase
5	9606.ENSP00000482907	0.902	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2
6	9606.ENSP00000371180	0.826	Cation channel sperm-associated protein 2
7	9606.ENSP00000401513	0.818	Stereocilin
8	9606.ENSP00000363046	0.796	Inositol polyphosphate multikinase
9	9606.ENSP00000300283	0.777	Creatine kinase, mitochondrial 1B
10	9606.ENSP00000406577	0.777	Creatine kinase U-type, mitochondrial
11	9606.ENSP00000439170	0.730	Tubulin-specific chaperone E
12	9606.ENSP00000251642	0.721	Probable ATP-dependent RNA helicase DHX58
13	9606.ENSP00000356213	0.674	VIP peptides
14	9606.ENSP00000261776	0.648	Protein VAC14 homolog
15	9606.ENSP00000267615	0.619	Inositol-tetrakisphosphate 1-kinase
16	9606.ENSP00000327246	0.581	Vasoactive intestinal polypeptide receptor 1
17	9606.ENSP00000462647	0.580	Pituitary adenylate cyclase-activating polypeptide
18	9606.ENSP00000219789	0.567	CDP-diacylglycerol--inositol 3-phosphatidyltransferase
19	9606.ENSP00000471896	0.552	Interferon regulatory factor 3
20	9606.ENSP00000263642	0.549	Interferon-induced helicase C domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0033857	1.000	diphosphoinositol-pentakisphosphate kinase activity
GO:0000828	1.000	inositol hexakisphosphate kinase activity
GO:0000829	0.984	inositol heptakisphosphate kinase activity
GO:0005488	0.599	binding
GO:0005515	0.337	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0008152	0.995	metabolic process
GO:0044238	0.951	primary metabolic process
GO:0071704	0.948	organic substance metabolic process
GO:0044237	0.945	cellular metabolic process
GO:0006793	0.885	phosphorus metabolic process
GO:0006796	0.852	phosphate-containing compound metabolic process
GO:0044281	0.836	small molecule metabolic process
GO:0019637	0.828	organophosphate metabolic process
GO:0019751	0.800	polyol metabolic process
GO:0043647	0.784	inositol phosphate metabolic process
GO:0044262	0.554	cellular carbohydrate metabolic process
GO:0065007	0.407	biological regulation
GO:0050896	0.346	response to stimulus
GO:0050789	0.303	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0043226	0.456	organelle
GO:0043231	0.427	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.4.-	1.000	Phosphotransferases with a phosphate group as acceptor.
EC:2.7.4.24	1.000	diphosphoinositol-pentakisphosphate 1-kinase.

[back to server]