StarFunc result for job id Q6PGN9

User Input

>input (363 residues)
MEDLEEDVRFIVDETLDFGGLSPSDSREEEDITVLVTPEKPLRRGLSHRSDPNAVAPAPQ
GVRLSLGPLSPEKLEEILDEANRLAAQLEQCALQDRESAGEGLGPRRVKPSPRRETFVLK
DSPVRDLLPTVNSLTRSTPSPSSLTPRLRSNDRKGSVRALRATSGKRPSNMKRESPTCNL
FPASKSPASSPLTRSTPPVRGRAGPSGRAAASEETRAAKLRVSGSGEFVGLTLKFLHPSP
PGPPTPIRSVLAPQPSTSNSQRLPRPQGAAAKSSSQLPIPSAIPRPASRMPLTSRSVPPG
RGALPPDSLSTRKGLPRPSTAGHRVRESGHKVPVSQRLNLPVMGATRSNLQPPRKVAVPG
PTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PGN9	1.000	1.000	5.034E-49	363	1.000	1.000	Q6PGN9.pdb.gz	PSRC1_HUMAN Proline/serine-rich coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=1
2	AFDB:A0A024R099	0.211	0.226	1.106E-39	333	0.917	1.000	A0A024R099.pdb.gz
3	AFDB:Q38ES8	0.098	0.061	5.408E-2	692	0.165	0.087	Q38ES8.pdb.gz	Q38ES8_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4770 PE=4 SV=1
4	AFDB:Q9C9L2	0.083	0.090	7.082E-2	325	0.152	0.169	Q9C9L2.pdb.gz	TCP15_ARATH Transcription factor TCP15 OS=Arabidopsis thaliana OX=3702 GN=TCP15 PE=1 SV=1
5	AFDB:Q8N9Y4	0.097	0.099	7.576E-2	354	0.198	0.203	Q8N9Y4.pdb.gz	F181A_HUMAN Protein FAM181A OS=Homo sapiens OX=9606 GN=FAM181A PE=1 SV=3
6	AFDB:Q38DL8	0.091	0.048	9.922E-2	746	0.138	0.067	Q38DL8.pdb.gz	Q38DL8_TRYB2 DNA repair protein RAD2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2870 PE=3 SV=1
7	AFDB:Q8NC74	0.090	0.059	1.061E-1	664	0.198	0.108	Q8NC74.pdb.gz	RB8NL_HUMAN RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=1 SV=3
8	AFDB:X1WBY5	0.092	0.075	1.215E-1	502	0.185	0.133	X1WBY5.pdb.gz	X1WBY5_DANRE Chromobox homolog 6b OS=Danio rerio OX=7955 GN=cbx6b PE=4 SV=1
9	AFDB:D6RIF6	0.093	0.085	1.299E-1	414	0.185	0.162	D6RIF6.pdb.gz	D6RIF6_HUMAN SLAIN motif family member 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=1
10	AFDB:Q8BHB3	0.088	0.079	1.390E-1	407	0.152	0.135	Q8BHB3.pdb.gz	LAX1_MOUSE Lymphocyte transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lax1 PE=2 SV=2
11	PDB:5o9zP	0.081	0.286	5.779	91	0.039	0.154	5o9zP.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
12	PDB:4jk1A	0.071	0.076	9.265	323	0.061	0.068	4jk1A.pdb.gz	Differential regulation by ppGpp versus pppGpp in Escherichia coli.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PGN9	0.0	695	363	1.000	1.000	PSRC1_HUMAN Proline/serine-rich coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=1
2	Q5T2Z1	2.41e-152	430	231	0.636	1.000	Q5T2Z1_HUMAN Proline and serine rich coiled-coil 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=8
3	Q5T2Z0	2.05e-140	399	205	0.565	1.000	Q5T2Z0_HUMAN Proline and serine rich coiled-coil 1 (Fragment) OS=Homo sapiens OX=9606 GN=PSRC1 PE=1 SV=2
4	Q9D0P7	2.34e-125	365	329	0.625	0.690	PSRC1_MOUSE Proline/serine-rich coiled-coil protein 1 OS=Mus musculus OX=10090 GN=Psrc1 PE=1 SV=2
5	P08096	2.7	32.7	1485	0.072	0.018	TOP2_SCHPO DNA topoisomerase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=top2 PE=1 SV=2
6	Q8IVL0	3.2	32.3	2385	0.061	0.009	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3
7	A6YQT5	5.6	31.6	2473	0.055	0.008	A6YQT5_PRRSV Non-structural protein OS=Porcine reproductive and respiratory syndrome virus OX=28344 PE=1 SV=1
8	Q80TN7	6.1	31.6	2359	0.105	0.016	NAV3_MOUSE Neuron navigator 3 OS=Mus musculus OX=10090 GN=Nav3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15259 GTSE1_N	2.9e-06	39.0	G-2 and S-phase expressed 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000005157

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000005153	0.803	Cadherin, EGF LAG seven-pass G-type receptor 2
2	9593.ENSGGOP00000006418	0.721	Sortilin 1
3	9593.ENSGGOP00000022362	0.641	Apolipoprotein A-IV
4	9593.ENSGGOP00000000655	0.615	Apolipoprotein A-V
5	9593.ENSGGOP00000008248	0.602	Jumonji domain containing 4
6	9593.ENSGGOP00000008252	0.602	Synaptosomal-associated protein, 47kDa
7	9593.ENSGGOP00000020629	0.572	Synaptophysin-like 2
8	9593.ENSGGOP00000006161	0.562	VPS54, GARP complex subunit
9	9593.ENSGGOP00000005164	0.543	Myosin binding protein H-like
10	9593.ENSGGOP00000025977	0.532	Ran GTPase activating protein 1
11	9593.ENSGGOP00000014556	0.531	Laminin, beta 2 (laminin S)
12	9593.ENSGGOP00000019017	0.529	Apolipoprotein C-III

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.993	regulation of cellular process
GO:0022402	0.963	cell cycle process
GO:0051179	0.962	localization
GO:0051234	0.945	establishment of localization
GO:1903047	0.943	mitotic cell cycle process
GO:0007059	0.914	chromosome segregation
GO:0071840	0.895	cellular component organization or biogenesis
GO:0016043	0.890	cellular component organization
GO:0140014	0.860	mitotic nuclear division
GO:0000070	0.851	mitotic sister chromatid segregation
GO:0051726	0.819	regulation of cell cycle
GO:0051128	0.752	regulation of cellular component organization
GO:0033043	0.737	regulation of organelle organization
GO:0051641	0.709	cellular localization
GO:0051649	0.692	establishment of localization in cell
GO:0051640	0.670	organelle localization
GO:0051493	0.647	regulation of cytoskeleton organization
GO:0032886	0.645	regulation of microtubule-based process
GO:0070507	0.626	regulation of microtubule cytoskeleton organization
GO:0010564	0.576	regulation of cell cycle process
GO:0051656	0.513	establishment of organelle localization
GO:0050000	0.509	chromosome localization
GO:0048518	0.459	positive regulation of biological process
GO:0048522	0.420	positive regulation of cellular process
GO:0019222	0.375	regulation of metabolic process
GO:0051310	0.336	metaphase plate congression
GO:0080090	0.333	regulation of primary metabolic process
GO:0007080	0.330	mitotic metaphase plate congression
GO:0090224	0.308	regulation of spindle organization
GO:0060236	0.304	regulation of mitotic spindle organization
GO:0060255	0.303	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0015630	0.706	microtubule cytoskeleton
GO:0005819	0.693	spindle
GO:0099512	0.612	supramolecular fiber
GO:0099513	0.536	polymeric cytoskeletal fiber
GO:0005874	0.533	microtubule
GO:0000922	0.430	spindle pole
GO:0005876	0.370	spindle microtubule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]