StarFunc result for job id Q6PGP7

User Input

>input (1564 residues)
MSSKEVKTALKSARDAIRNKEYKEALKHCKTVLKQEKNNYNAWVFIGVAAAELEQPDQAQ
SAYKKAAELEPDQLLAWQGLANLYEKYNHINAKDDLPGVYQKLLDLYESVDKQKWCDVCK
KLVDLYYQEKKHLEVARTWHKLIKTRQEQGAENEELHQLWRKLTQFLAESTEDQNNETQQ
LLFTAFENALGLSDKIPSEDHQVLYRHFIQSLSKFPHESARLKKACEGMINIYPTVQYPL
EVLCLHLIESGNLTDEGQQYCCRLVEMDSKSGPGLIGLGIKALQDKKYEDAVRNLTEGLK
ESPVCTSGWYHLAEAQVKMHRPKEAVLSCSQALKIVDNLGASGNSLYQRNLCLHLKAEAL
IKLSDYDSSEEAIRTLDQISDADNIPGLLVLKSLAYRNKGSFDEAAKIMEDLLSSYPDLA
EVHALEALIHFTKKDYLQAEKCFQRALEKDTEVAEYHYQLGLTYWFMGEETRKDKTKALT
HFLKAARLDTYMGKVFCYLGHYYRDVVGDKNRARGCYRKAFELDDTDAESGAAAVDLSVE
LEDMEMALAILTTVTQKASAGTAKWAWLRRGLYYLKAGQHSQAVADLQAALRADPKDFNC
WESLGEAYLSRGGYTTALKSFTKASELNPESIYSVFKVAAIQQILGKYKEAVAQYQMIIK
KKEDYVPALKGLGECHLMMAKAALVDYLDGKAVDYIEKALEYFTCALQHRADVSCLWKLA
GDACTCLYAVAPSKVNVHVLGVLLGQKEGKQVLKKNELLHLGGRCYGRALKLMSTSNTWC
DLGINYYRQAQHLAETGSNMNDLKELLEKSLHCLKKAVRLDSNNHLYWNALGVVACYSGI
GNYALAQHCFIKSIQSEQINAVAWTNLGVLYLTNENIEQAHEAFKMAQSLDPSYLMCWIG
QALIAEAVGSYDTMDLFRHTTELNMHTEGALGYAYWVCTTLQDKSNRETELYQYNILQMN
AIPAAQVILNKYVERIQNYAPAFTMLGYLNEHLQLKKEAANAYQRAILLLQTAEDQDTYN
VAIRNYGRLLCSTGEYDKAIQAFKSTPLEVLEDIIGFALALFMKGLYKESSKAYERALSI
VESEQDKAHILTALAITEYKQGKTDVAKTLLFKCSILKEPTTESLQALCALGLAMQDATL
SKAALNELLKHIKHKDSNYQRCLLTSAIYALQGRSVAVQKQISKAVHSNPGDPALWSLLS
RVVAQYAQRNAKGGVVAGNVAHILDSNHGKKALLYTAVNQLAMGSSSAEDEKNTALKTIQ
KAALLSPGDPAIWAGLMAACHADDKLALVNNTQPKRIDLYLALLSAVSASIKDEKFFENY
NQSLEKWSLSQAVTGLIDTGRISEAETLCTKNLKSNPDQPAVILLLRQVQCKPLLESQKP
LPDAVLEELQKTVMSNSTSVPAWQWLAHVYQSQGMMRAAEMCYRKSLQLASQRGSWSGKL
SSLLRLALLALKVCMANISNDHWPSLVQEATTEALKLCFCPLAVLLQALLQFKRKMGARE
TRRLLERVVYQPGYPKSIASTARWYLLRHLYAKDDYELIDVLVNNAKTHGDTRALELNQR
LSSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PGP7	1.000	1.000	0.000	1564	1.000	1.000	Q6PGP7.pdb.gz	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
2	PDB:7qdrB	0.688	0.871	1.323E-101	1212	0.774	0.999	7qdrB.pdb.gz
3	AFDB:Q6NNB2	0.529	0.647	7.026E-46	1233	0.199	0.253	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
4	AFDB:Q54HV0	0.429	0.376	2.026E-43	1825	0.212	0.181	Q54HV0.pdb.gz	Q54HV0_DICDI Tetratricopeptide-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1091 PE=4 SV=1
5	AFDB:O94474	0.509	0.562	1.370E-38	1389	0.180	0.202	O94474.pdb.gz	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
6	AFDB:P17883	0.394	0.424	2.612E-30	1432	0.148	0.161	P17883.pdb.gz	SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI3 PE=1 SV=2
7	AFDB:F4I3Z5	0.385	0.498	1.279E-29	1168	0.147	0.197	F4I3Z5.pdb.gz	SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana OX=3702 GN=SKI3 PE=1 SV=1
8	PDB:4bujB	0.496	0.557	3.413E-28	1367	0.146	0.167	4bujB.pdb.gz
9	AFDB:B0R0W1	0.166	0.192	2.199E-21	1321	0.116	0.138	B0R0W1.pdb.gz	B0R0W1_DANRE Tetratricopeptide repeat domain 21B OS=Danio rerio OX=7955 GN=sb:cb947 PE=1 SV=1
10	AFDB:Q7Z4L5	0.165	0.191	2.613E-21	1316	0.110	0.131	Q7Z4L5.pdb.gz	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
11	AFDB:Q38EI1	0.161	0.179	7.115E-21	1351	0.134	0.155	Q38EI1.pdb.gz	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
12	AFDB:Q0HA38	0.162	0.186	1.195E-20	1315	0.126	0.150	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
13	PDB:7dkhI	0.153	0.232	3.261E-14	914	0.096	0.164	7dkhI.pdb.gz
14	PDB:7sqcR1	0.147	0.119	1.988E-12	2080	0.142	0.107	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
15	PDB:6tedQ	0.178	0.283	3.702E-12	890	0.091	0.161	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:7n6g1N	0.150	0.116	1.712E-10	2179	0.145	0.104	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.
17	PDB:7ntfA	0.210	0.342	4.202E-10	918	0.055	0.094	7ntfA.pdb.gz
18	PDB:7tyrA	0.147	0.075	2.907E-9	3905	0.150	0.060	7tyrA.pdb.gz
19	PDB:6bq1B	0.138	0.262	7.647E-9	728	0.069	0.148	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
20	PDB:6yj6A	0.115	0.189	8.481E-9	819	0.079	0.151	6yj6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6RCE2	0.0	1244	611	0.391	1.000	D6RCE2_HUMAN SKI3 subunit of superkiller complex (Fragment) OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
2	Q6PGP7	0.0	3224	1564	1.000	1.000	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
3	Q6NNB2	1.09e-87	315	1233	0.154	0.195	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
4	Q961V6	1.23e-65	238	640	0.122	0.298	Q961V6_DROME GH04440p OS=Drosophila melanogaster OX=7227 GN=CG8777 PE=2 SV=1
5	O94474	8.54e-53	206	1389	0.139	0.156	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
6	F4I3Z5	2.12e-39	162	1168	0.085	0.114	SKI3_ARATH Tetratricopeptide repeat protein SKI3 OS=Arabidopsis thaliana OX=3702 GN=SKI3 PE=1 SV=1
7	Q54HV0	1.34e-34	147	1825	0.078	0.067	Q54HV0_DICDI Tetratricopeptide-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1091 PE=4 SV=1
8	P17883	1.68e-12	75.1	1432	0.105	0.115	SKI3_YEAST Superkiller protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI3 PE=1 SV=2
9	Q9M8Y0	1.61e-09	65.5	977	0.055	0.088	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
10	Q57WP4	5.18e-09	63.5	673	0.042	0.097	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
11	Q5GA11	4.91e-07	57.4	1046	0.042	0.062	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
12	O18158	5.62e-07	57.0	1151	0.063	0.085	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
13	Q5GA10	5.70e-07	57.0	1036	0.042	0.063	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
14	Q5GA13	5.93e-07	57.0	1062	0.042	0.061	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
15	Q5GA12	6.02e-07	57.0	1052	0.042	0.062	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
16	Q2L6Y4	6.46e-07	56.6	973	0.063	0.101	Q2L6Y4_CAEEL protein O-GlcNAc transferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=1
17	Q8CGY8	8.50e-07	56.6	1046	0.042	0.062	OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
18	P81436	8.72e-07	56.2	1046	0.042	0.062	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
19	P56558	8.92e-07	56.2	1036	0.042	0.063	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
20	O15294	8.94e-07	56.2	1046	0.042	0.062	OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	5.5e-07	41.1	Anaphase-promoting complex, cyclosome, subunit 3
2	PF03704 BTAD	2.1e+02	13.7	Bacterial transcriptional activator domain
3	PF04733 Coatomer_E	47	14.8	Coatomer epsilon subunit
4	PF06169 DUF982	1.6e+02	13.7	Protein of unknown function (DUF982)
5	PF14853 Fis1_TPR_C	0.0009	30.7	Fis1 C-terminal tetratricopeptide repeat
6	PF09613 HrpB1_HrpK	7.5e+02	11.2	Bacterial type III secretion protein (HrpB1_HrpK)
7	PF14223 Retrotran_gag_2	2.8e+02	12.7	gag-polypeptide of LTR copia-type
8	PF08238 Sel1	0.046	25.7	Sel1 repeat
9	PF20308 TPR-S	24	16.9	Tetratricopeptide Repeats-Sensor
10	PF00515 TPR_1	2.6e-44	158.4	Tetratricopeptide repeat
11	PF13374 TPR_10	2.2e+02	13.2	Tetratricopeptide repeat
12	PF13414 TPR_11	5.7e-23	91.6	TPR repeat
13	PF13424 TPR_12	2e-20	84.2	Tetratricopeptide repeat
14	PF13428 TPR_14	8.5e-25	96.2	Tetratricopeptide repeat
15	PF13429 TPR_15	0.00086	30.3	Tetratricopeptide repeat
16	PF13432 TPR_16	1.2e-28	110.7	Tetratricopeptide repeat
17	PF13431 TPR_17	1.8e-20	82.8	Tetratricopeptide repeat
18	PF14559 TPR_19	5.1e-33	124.7	Tetratricopeptide repeat
19	PF07719 TPR_2	1e-42	151.8	Tetratricopeptide repeat
20	PF14561 TPR_20	6.8	18.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267973	0.999	WD repeat-containing protein 61
2	9606.ENSP00000364543	0.999	Helicase SKI2W
3	9606.ENSP00000356811	0.958	HBS1-like protein
4	9606.ENSP00000359939	0.949	Exosome complex component CSL4
5	9606.ENSP00000264951	0.947	5'-3' exoribonuclease 1
6	9606.ENSP00000315476	0.938	Exosome complex component RRP41
7	9606.ENSP00000230640	0.932	Superkiller viralicidic activity 2-like 2
8	9606.ENSP00000368984	0.914	Exosome complex component RRP45
9	9606.ENSP00000221233	0.908	Exosome complex component RRP46
10	9606.ENSP00000265564	0.897	Exosome complex component RRP42
11	9606.ENSP00000323046	0.897	Exosome complex component RRP40
12	9606.ENSP00000366997	0.893	Exosome complex exonuclease RRP44
13	9606.ENSP00000374354	0.872	Exosome complex component RRP43
14	9606.ENSP00000398597	0.872	Exosome complex component MTR3
15	9606.ENSP00000366135	0.846	Exosome component 10
16	9606.ENSP00000361433	0.798	Exosome complex component RRP4
17	9606.ENSP00000378320	0.780	Tetratricopeptide repeat protein 7A
18	9606.ENSP00000348107	0.722	Nuclear nucleic acid-binding protein C1D
19	9606.ENSP00000443113	0.720	Zinc finger CCHC-type containing 7
20	9606.ENSP00000373715	0.707	m7GpppN-mRNA hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0043170	0.968	macromolecule metabolic process
GO:0065007	0.962	biological regulation
GO:0050789	0.948	regulation of biological process
GO:0034641	0.814	cellular nitrogen compound metabolic process
GO:0019222	0.784	regulation of metabolic process
GO:0044260	0.597	cellular macromolecule metabolic process
GO:0050794	0.487	regulation of cellular process
GO:1901360	0.449	organic cyclic compound metabolic process
GO:0046483	0.449	heterocycle metabolic process
GO:0048519	0.448	negative regulation of biological process
GO:0006725	0.441	cellular aromatic compound metabolic process
GO:0060255	0.438	regulation of macromolecule metabolic process
GO:0006139	0.434	nucleobase-containing compound metabolic process
GO:0090304	0.411	nucleic acid metabolic process
GO:0016070	0.358	RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005829	1.000	cytosol
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.920	chromosome
GO:0000791	0.893	euchromatin
GO:0055087	0.686	Ski complex
GO:0016020	0.488	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]