StarFunc result for job id Q6PGQ7

User Input

>input (559 residues)
MGDVKESKMQITPETPGRIPVLNPFESPSDYSNLHEQTLASPSVFKSTKLPTPGKFRWSI
DQLAVINPVEIDPEDIHRQALYLSHSRIDKDVEDKRQKAIEEFFTKDVIVPSPWTDHEGK
QLSQCHSSKCTNINSDSPVGKKLTIHSEKSDAACQTLLSLPVDFNLENILGDYFRADEFA
DQSPGNLSSSSLRRKLFLDGNGSISDSLPSASPGSPHSGVQTSLEMFYSIDLSPVKCRSP
LQTPSSGQFSSSPIQASAKKYSLGSITSPSPISSPTFSPIEFQIGETPLSEQRKFTVHSP
DASSGTNSNGITNPCIRSPYIDGCSPIKNWSPMRLQMYSGGTQYRTSVIQIPFTLETQGE
DEEDKENIPSTDVSSPAMDAAGIHLRQFSNEASTHGTHLVVTAMSVTQNQSSASEKELAL
LQDVEREKDNNTVDMVDPIEIADETTWIKEPVDNGSLPMTDFVSGIAFSIENSHMCMSPL
AESSVIPCESSNIQMDSGYNTQNCGSNIMDTVGAESYCKESDAQTCEVESKSQAFNMKQD
HTTQRCWMKTASPFQCSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PGQ7	1.000	1.000	1.474E-75	559	1.000	1.000	Q6PGQ7.pdb.gz	BORA_HUMAN Protein aurora borealis OS=Homo sapiens OX=9606 GN=BORA PE=1 SV=2
2	AFDB:Q8C7E9	0.055	0.050	5.674E-1	632	0.136	0.120	Q8C7E9.pdb.gz	CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus OX=10090 GN=Cstf2t PE=1 SV=2
3	AFDB:Q9BZA8	0.055	0.030	6.467E-1	1340	0.163	0.068	Q9BZA8.pdb.gz	PC11Y_HUMAN Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1
4	AFDB:Q86VM9	0.065	0.047	8.400E-1	953	0.147	0.086	Q86VM9.pdb.gz	ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2
5	AFDB:B0V0H4	0.063	0.037	8.968E-1	1071	0.143	0.075	B0V0H4.pdb.gz
6	AFDB:Q4WCP6	0.067	0.047	1.022	881	0.181	0.115	Q4WCP6.pdb.gz	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
7	AFDB:P31264	0.070	0.054	1.091	782	0.159	0.114	P31264.pdb.gz	HMPB_DROME Homeotic protein proboscipedia OS=Drosophila melanogaster OX=7227 GN=pb PE=2 SV=2
8	AFDB:Q76KD6	0.066	0.064	1.417	591	0.152	0.144	Q76KD6.pdb.gz	SPERI_HUMAN Speriolin OS=Homo sapiens OX=9606 GN=SPATC1 PE=2 SV=2
9	AFDB:F1Q910	0.056	0.058	1.725	529	0.140	0.147	F1Q910.pdb.gz
10	AFDB:Q9C0J8	0.072	0.035	1.966	1336	0.154	0.064	Q9C0J8.pdb.gz	WDR33_HUMAN pre-mRNA 3' end processing protein WDR33 OS=Homo sapiens OX=9606 GN=WDR33 PE=1 SV=2
11	PDB:6qdvO	0.051	0.064	9.411	441	0.023	0.029	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
12	PDB:6zr2h	0.062	0.162	9.411	138	0.023	0.094	6zr2h.pdb.gz	Structure of inhibitor-bound mammalian complex I.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PGQ7	0.0	1152	559	1.000	1.000	BORA_HUMAN Protein aurora borealis OS=Homo sapiens OX=9606 GN=BORA PE=1 SV=2
2	Q8BS90	0.0	697	525	0.678	0.722	BORA_MOUSE Protein aurora borealis OS=Mus musculus OX=10090 GN=Bora PE=1 SV=1
3	Q9VVR2	6.31e-11	67.4	539	0.147	0.152	BORA_DROME Protein aurora borealis OS=Drosophila melanogaster OX=7227 GN=bora PE=1 SV=1
4	G5ECT7	0.002	43.1	545	0.059	0.061	G5ECT7_CAEEL Protein aurora borealis OS=Caenorhabditis elegans OX=6239 GN=spat-1 PE=1 SV=1
5	H2FLK2	0.002	43.1	547	0.059	0.060	H2FLK2_CAEEL Protein aurora borealis OS=Caenorhabditis elegans OX=6239 GN=spat-1 PE=1 SV=1
6	F1SX59	2.4	33.9	3382	0.041	0.007	F1SX59_PIG Versican OS=Sus scrofa OX=9823 GN=VCAN PE=2 SV=1
7	Q936X2	5.6	32.3	605	0.047	0.043	ATZF_PSESD Allophanate hydrolase OS=Pseudomonas sp. (strain ADP) OX=47660 GN=atzF PE=1 SV=1
8	O35054	8.4	31.2	210	0.023	0.062	CLD4_MOUSE Claudin-4 OS=Mus musculus OX=10090 GN=Cldn4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15280 BORA_N	1.2e-72	255.8	Protein aurora borealis N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000479266

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216911	0.998	Aurora kinase A
2	9606.ENSP00000300093	0.997	Serine/threonine-protein kinase PLK1
3	9606.ENSP00000256442	0.965	G2/mitotic-specific cyclin-B1
4	9606.ENSP00000288207	0.952	G2/mitotic-specific cyclin-B2
5	9606.ENSP00000378699	0.935	Cyclin-dependent kinase 1
6	9606.ENSP00000313950	0.845	Aurora kinase B
7	9606.ENSP00000260731	0.816	Kinesin-like protein KIF11
8	9606.ENSP00000359206	0.800	F-box/WD repeat-containing protein 1A
9	9606.ENSP00000247191	0.778	Disks large-associated protein 5
10	9606.ENSP00000358813	0.773	Dual specificity protein kinase TTK
11	9606.ENSP00000376457	0.712	Protein ECT2
12	9606.ENSP00000326804	0.710	Cullin-1
13	9606.ENSP00000404190	0.709	Rac GTPase-activating protein 1
14	9606.ENSP00000481495	0.708	ATP-dependent RNA helicase DDX24
15	9606.ENSP00000312995	0.700	Claspin
16	9606.ENSP00000231487	0.695	S-phase kinase-associated protein 1
17	9606.ENSP00000206595	0.693	G2/M phase-specific E3 ubiquitin-protein ligase
18	9606.ENSP00000371858	0.693	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
19	9606.ENSP00000296509	0.690	Mitotic spindle assembly checkpoint protein MAD2A
20	9606.ENSP00000305204	0.688	Cytoskeleton-associated protein 2-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0033043	0.985	regulation of organelle organization
GO:0010564	0.984	regulation of cell cycle process
GO:0007346	0.982	regulation of mitotic cell cycle
GO:0051783	0.938	regulation of nuclear division
GO:0007088	0.920	regulation of mitotic nuclear division
GO:0032886	0.852	regulation of microtubule-based process
GO:0070507	0.789	regulation of microtubule cytoskeleton organization
GO:0060341	0.726	regulation of cellular localization
GO:0090224	0.691	regulation of spindle organization
GO:0060236	0.667	regulation of mitotic spindle organization
GO:0032880	0.645	regulation of protein localization
GO:0009987	0.636	cellular process
GO:0048518	0.349	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.919	nucleus
GO:0005654	0.911	nucleoplasm
GO:0043232	0.884	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]