StarFunc result for job id Q6PHW0

User Input

>input (289 residues)
MYFLTPILVAILCILVVWIFKNADRSMEKKKGEPRTRAEARPWVDEDLKDSSDLHQAEED
ADEWQESEENVEHIPFSHNHYPEKEMVKRSQEFYELLNKRRSVRFISNEQVPMEVIDNVI
RTAGTAPSGAHTEPWTFVVVKDPDVKHKIRKIIEEEEEINYMKRMGHRWVTDLKKLRTNW
IKEYLDTAPILILIFKQVHGFAANGKKKVHYYNEISVSIACGILLAALQNAGLVTVTTTP
LNCGPRLRVLLGRPAHEKLLMLLPVGYPSKEATVPDLKRKPLDQIMVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PHW0	1.000	1.000	1.124E-54	289	1.000	1.000	Q6PHW0.pdb.gz	IYD1_HUMAN Iodotyrosine deiodinase 1 OS=Homo sapiens OX=9606 GN=IYD PE=1 SV=2
2	AFDB:Q6TA49	0.878	0.878	3.733E-49	289	0.851	0.851	Q6TA49.pdb.gz	IYD1_PIG Iodotyrosine deiodinase 1 OS=Sus scrofa OX=9823 GN=IYD PE=1 SV=1
3	AFDB:Q9DCX8	0.847	0.858	4.210E-45	285	0.844	0.856	Q9DCX8.pdb.gz	IYD1_MOUSE Iodotyrosine deiodinase 1 OS=Mus musculus OX=10090 GN=Iyd PE=1 SV=1
4	AFDB:E7FDV5	0.872	0.855	6.343E-43	295	0.664	0.651	E7FDV5.pdb.gz	IYD_DANRE Iodotyrosine deiodinase OS=Danio rerio OX=7955 GN=iyd PE=1 SV=1
5	AFDB:F6VN83	0.704	0.715	5.848E-36	284	0.824	0.838	F6VN83.pdb.gz	F6VN83_HUMAN Iodotyrosine deiodinase 1 OS=Homo sapiens OX=9606 GN=IYD PE=1 SV=1
6	AFDB:A7S5D9	0.773	0.845	5.363E-35	264	0.516	0.564	A7S5D9.pdb.gz	IYD_NEMVE Iodotyrosine deiodinase OS=Nematostella vectensis OX=45351 GN=v1g105379 PE=1 SV=1
7	AFDB:T2MBC4	0.754	0.801	6.027E-35	272	0.516	0.548	T2MBC4.pdb.gz	IYD_HYDVU Iodotyrosine deiodinase OS=Hydra vulgaris OX=6087 GN=IYD PE=1 SV=1
8	AFDB:E9FR69	0.767	0.739	5.527E-34	300	0.516	0.497	E9FR69.pdb.gz	IYD_DAPPU Iodotyrosine deiodinase OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_205384 PE=1 SV=1
9	AFDB:E1JIB2	0.747	0.752	3.578E-31	287	0.478	0.481	E1JIB2.pdb.gz	IYD_DROME Iodotyrosine deiodinase OS=Drosophila melanogaster OX=7227 GN=Iyd PE=1 SV=1
10	AFDB:F4KU78	0.747	0.969	3.015E-27	222	0.339	0.441	F4KU78.pdb.gz	IYD_HALH1 Iodotyrosine deiodinase OS=Haliscomenobacter hydrossis (strain ATCC 27775 / DSM 1100 / LMG 10767 / O) OX=760192 GN=IYD PE=1 SV=1
11	PDB:5ko8B	0.737	0.973	1.126E-26	218	0.339	0.450	5ko8B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
12	PDB:5ko7B	0.656	0.942	1.347E-22	200	0.308	0.445	5ko7B.pdb.gz	Active Site Binding Is Not Sufficient for Reductive Deiodination by Iodotyrosine Deiodinase.
13	PDB:6pz0A	0.583	0.897	6.343E-17	185	0.218	0.341	6pz0A.pdb.gz	The minimal structure for iodotyrosine deiodinase function is defined by an outlier protein from the thermophilic bacterium Thermotoga neapolitana.
14	PDB:2isjA	0.579	0.743	8.781E-12	219	0.135	0.178	2isjA.pdb.gz	BluB cannibalizes flavin to form the lower ligand of vitamin B12.
15	PDB:2wzvB	0.515	0.653	5.205E-10	223	0.170	0.220	2wzvB.pdb.gz	Biological and Structural Characterization of the Mycobacterium Smegmatis Nitroreductase Nfnb, and its Role in Benzothiazinone Resistance
16	PDB:3bm1A	0.453	0.704	2.236E-9	177	0.128	0.209	3bm1A.pdb.gz	Crystal structure of a minimal nitroreductase, ydjA, from Escherichia coli K12 with and without FMN cofactor
17	PDB:1f5vA	0.497	0.592	2.513E-9	240	0.118	0.142	1f5vA.pdb.gz	Structure and site-directed mutagenesis of a flavoprotein from Escherichia coli that reduces nitrocompounds: alteration of pyridine nucleotide binding by a single amino acid substitution.
18	PDB:1ds7A	0.514	0.673	1.722E-8	217	0.118	0.157	1ds7A.pdb.gz	Crystal structure of FMN-dependent nitroreductase from Escherichia coli B: a prodrug-activating enzyme.
19	PDB:2h0uA	0.405	0.577	2.379E-5	196	0.093	0.138	2h0uA.pdb.gz	Crystal structure of NAD(P)H-flavin oxidoreductase from Helicobacter pylori
20	PDB:4urpA	0.423	0.655	5.706E-5	178	0.080	0.129	4urpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PHW0	0.0	598	289	1.000	1.000	IYD1_HUMAN Iodotyrosine deiodinase 1 OS=Homo sapiens OX=9606 GN=IYD PE=1 SV=2
2	Q9DCX8	1.82e-179	497	285	0.848	0.860	IYD1_MOUSE Iodotyrosine deiodinase 1 OS=Mus musculus OX=10090 GN=Iyd PE=1 SV=1
3	Q6TA49	9.51e-175	486	289	0.851	0.851	IYD1_PIG Iodotyrosine deiodinase 1 OS=Sus scrofa OX=9823 GN=IYD PE=1 SV=1
4	F6VN83	9.43e-172	478	284	0.834	0.849	F6VN83_HUMAN Iodotyrosine deiodinase 1 OS=Homo sapiens OX=9606 GN=IYD PE=1 SV=1
5	C9JXJ9	2.33e-171	476	270	0.799	0.856	C9JXJ9_HUMAN Iodotyrosine deiodinase 1 OS=Homo sapiens OX=9606 GN=IYD PE=1 SV=2
6	E7FDV5	3.90e-133	380	295	0.668	0.654	IYD_DANRE Iodotyrosine deiodinase OS=Danio rerio OX=7955 GN=iyd PE=1 SV=1
7	A7S5D9	1.29e-107	315	264	0.522	0.572	IYD_NEMVE Iodotyrosine deiodinase OS=Nematostella vectensis OX=45351 GN=v1g105379 PE=1 SV=1
8	E9FR69	3.77e-105	310	300	0.516	0.497	IYD_DAPPU Iodotyrosine deiodinase OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_205384 PE=1 SV=1
9	T2MBC4	1.98e-99	294	272	0.491	0.522	IYD_HYDVU Iodotyrosine deiodinase OS=Hydra vulgaris OX=6087 GN=IYD PE=1 SV=1
10	E1JIB2	1.14e-86	262	287	0.474	0.477	IYD_DROME Iodotyrosine deiodinase OS=Drosophila melanogaster OX=7227 GN=Iyd PE=1 SV=1
11	F4KU78	1.45e-66	209	222	0.339	0.441	IYD_HALH1 Iodotyrosine deiodinase OS=Haliscomenobacter hydrossis (strain ATCC 27775 / DSM 1100 / LMG 10767 / O) OX=760192 GN=IYD PE=1 SV=1
12	B9K712	6.58e-24	97.8	186	0.211	0.328	IYD_THENN Iodotyrosine deiodinase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=IYD PE=1 SV=1
13	Q2RNG5	7.34e-05	45.1	211	0.166	0.227	BLUB_RHORT 5,6-dimethylbenzimidazole synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=Rru_A3536 PE=1 SV=1
14	P9WP79	1.03e-04	45.8	448	0.142	0.092	FBIB_MYCTU Bifunctional F420 biosynthesis protein FbiB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fbiB PE=1 SV=1
15	O07233	1.30e-04	44.7	223	0.166	0.215	O07233_MYCTU Oxidoreductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0306 PE=4 SV=1
16	Q8Y9P0	7.96e-04	42.0	191	0.159	0.241	Q8Y9P0_LISMO Lmo0485 protein OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=lmo0485 PE=4 SV=1
17	A0R6D0	0.002	41.2	234	0.076	0.094	NFNB_MYCS2 Nitroreductase NfnB OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=nfnB PE=1 SV=1
18	Q92PC8	0.019	38.1	227	0.156	0.198	BLUB_RHIME 5,6-dimethylbenzimidazole synthase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=bluB PE=1 SV=1
19	Q8GED9	0.58	33.5	219	0.052	0.068	ALBA_STRNR Albonoursin synthase OS=Streptomyces noursei OX=1971 GN=albA PE=1 SV=1
20	Q9FD36	0.74	33.1	227	0.055	0.070	Q9FD36_PSEPU PnbA OS=Pseudomonas putida OX=303 GN=pnbA PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14851 FAM176	1.3e+02	13.8	FAM176 family
2	PF00881 Nitroreductase	4e-15	67.8	Nitroreductase family
3	PF14512 TM1586_NiRdase	0.018	26.2	Putative TM nitroreductase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000019149

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000010898	0.820	Solute carrier family 5 (sodium/iodide cotransporter), member 5
2	9601.ENSPPYP00000015033	0.756	Monoglyceride lipase
3	9601.ENSPPYP00000005573	0.754	Pongo abelii phenylalanine hydroxylase (PAH), mRNA
4	9601.ENSPPYP00000007296	0.719	Dual oxidase maturation factor 2
5	9601.ENSPPYP00000005632	0.709	Methylmalonic aciduria (cobalamin deficiency) cblB type
6	9601.ENSPPYP00000007295	0.695	Dual oxidase 2
7	9601.ENSPPYP00000023451	0.693	Cytochrome b
8	9601.ENSPPYP00000010979	0.684	Cytochrome b-c1 complex subunit Rieske, mitochondrial
9	9601.ENSPPYP00000020068	0.667	Pendrin
10	9601.ENSPPYP00000014164	0.636	Thyroid peroxidase
11	9601.ENSPPYP00000003286	0.631	Essential component of the apolipoprotein B mRNA editing enzyme complex which is responsible for the postranscriptional editing of a CAA codon for Gln to a UAA codon for stop in APOB mRNA. Binds to APOB mRNA and is probably responsible for docking the catalytic subunit, APOBEC1, to the mRNA to allow it to deaminate its target cytosine. The complex also seems to protect the edited APOB mRNA from nonsense-mediated decay (By similarity).
12	9601.ENSPPYP00000015436	0.631	May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes
13	9601.ENSPPYP00000016920	0.628	Fibrinogen alpha chain
14	9601.ENSPPYP00000015878	0.627	Regulates the adhesive and proliferative status of intestinal epithelial cells. Can mediate density-dependent cell proliferation
15	9601.ENSPPYP00000023262	0.627	Coagulation factor IX
16	9601.ENSPPYP00000000566	0.624	Antithrombin-III
17	9601.ENSPPYP00000013149	0.624	Transmembrane protease, serine 6
18	9601.ENSPPYP00000019148	0.621	Protein phosphatase 1, regulatory (inhibitor) subunit 14C
19	9601.ENSPPYP00000006087	0.617	Carboxypeptidase B2 (plasma)
20	9601.ENSPPYP00000016087	0.617	Histidine-rich glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140616	1.000	iodotyrosine deiodinase activity
GO:0010181	1.000	FMN binding
GO:0005515	0.891	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901605	0.995	alpha-amino acid metabolic process
GO:0009072	0.995	aromatic amino acid metabolic process
GO:0006570	0.992	tyrosine metabolic process
GO:0065008	0.983	regulation of biological quality
GO:0006575	0.973	cellular modified amino acid metabolic process
GO:0042445	0.943	hormone metabolic process
GO:1901615	0.937	organic hydroxy compound metabolic process
GO:0018958	0.927	phenol-containing compound metabolic process
GO:0042403	0.306	thyroid hormone metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0070013	0.994	intracellular organelle lumen
GO:0031981	0.968	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0005737	0.927	cytoplasm
GO:0031982	0.870	vesicle
GO:0031090	0.473	organelle membrane
GO:0005576	0.451	extracellular region
GO:0097708	0.418	intracellular vesicle
GO:0031410	0.413	cytoplasmic vesicle
GO:0012505	0.381	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:32479	1.000	2 iodide + L-tyrosine + 2 NADP(+) = 3,5-diiodo-L-tyrosine + H(+) + 2 NADPH
EC:1.21.1.1	1.000	iodotyrosine deiodinase.

[back to server]