StarFunc result for job id Q6PI26

User Input

>input (577 residues)
MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLRLTLPGRIVENGS
EQGSYDADKGIFTIRLPKETPGQHFEGLNMLTALLAPRKSRTAKPLVEEIGASEIPEEVV
DDEEFDWEIEQTPCEEVSESALNPQCHYGFGNLRSGVLQRLQDELSDVIDIKDPDFTPAA
ERRQKRLAAELAKFDPDHYLADFFEDEAIEQILKYNPWWTDKYSKMMAFLEKSQEQENHA
TLVSFSEEEKYQLRKFVNKSYLLDKRACRQVCYSLIDILLAYCYETRVTEGEKNVESAWN
IRKLSPTLCWFETWTNVHDIMVSFGRRVLCYPLYRHFKLVMKAYRDTIKILQLGKSAVLK
CLLDIHKIFQENDPAYILNDLYISDYCVWIQKVKSKKLAALAEALKEVSLTKAQLGLELE
ELEAAALLVQEEETALKAAHSVSGQQTLCSSSEASDSEDSDSSVSSGNEDSGSDSEQDEL
KDSPSETVSSLQGPFLEESSAFLIVDGGVRRNTAIQESDASQGKPLASSWPLGVSGPLIE
ELGEQLKTTVQVSEPKGTTAVNRSNIQERDGCQTPNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PI26	1.000	1.000	7.323E-89	577	1.000	1.000	Q6PI26.pdb.gz	SHQ1_HUMAN Protein SHQ1 homolog OS=Homo sapiens OX=9606 GN=SHQ1 PE=1 SV=2
2	AFDB:O43076	0.630	0.798	9.934E-37	451	0.267	0.341	O43076.pdb.gz	SHQ1_SCHPO Protein shq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shq1 PE=3 SV=1
3	AFDB:P40486	0.566	0.638	1.426E-27	507	0.210	0.239	P40486.pdb.gz	SHQ1_YEAST Protein SHQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHQ1 PE=1 SV=1
4	PDB:7krjC	0.139	0.568	9.072E-5	133	0.028	0.120	7krjC.pdb.gz	Structure of Hsp90-p23-GR reveals the Hsp90 client-remodelling mechanism.
5	PDB:3w1zB	0.124	0.465	3.275E-4	143	0.026	0.105	3w1zB.pdb.gz
6	PDB:4ylbA	0.122	0.519	1.441E-3	128	0.026	0.117	4ylbA.pdb.gz
7	PDB:2kmwA	0.132	0.457	2.738E-3	150	0.028	0.107	2kmwA.pdb.gz
8	AFDB:A0A024R5L7	0.078	0.075	2.969E-3	610	0.094	0.089	A0A024R5L7.pdb.gz
9	AFDB:Q7M6Y3	0.080	0.074	3.617E-3	660	0.097	0.085	Q7M6Y3.pdb.gz	PICAL_MOUSE Phosphatidylinositol-binding clathrin assembly protein OS=Mus musculus OX=10090 GN=Picalm PE=1 SV=1
10	PDB:1shsA	0.130	0.610	4.951E-3	115	0.019	0.096	1shsA.pdb.gz
11	AFDB:P13365	0.099	0.099	6.541E-3	580	0.121	0.121	P13365.pdb.gz	CG13_YEAST G1/S-specific cyclin CLN3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLN3 PE=1 SV=2
12	AFDB:Q8C0Y0	0.114	0.085	6.873E-3	875	0.099	0.065	Q8C0Y0.pdb.gz	PP4R4_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 4 OS=Mus musculus OX=10090 GN=Ppp4r4 PE=1 SV=2
13	PDB:1gmeA	0.116	0.417	6.996E-3	150	0.033	0.127	1gmeA.pdb.gz
14	AFDB:Q9QZA2	0.071	0.057	7.970E-3	873	0.113	0.074	Q9QZA2.pdb.gz	PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus OX=10116 GN=Pdcd6ip PE=1 SV=2
15	PDB:4ydzA	0.114	0.428	9.408E-3	135	0.028	0.119	4ydzA.pdb.gz
16	AFDB:B0M0P8	0.083	0.037	9.710E-3	2356	0.114	0.028	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
17	AFDB:Q9VB25	0.079	0.049	1.183E-2	1265	0.135	0.062	Q9VB25.pdb.gz	KL98A_DROME Kinesin-like protein Klp98A OS=Drosophila melanogaster OX=7227 GN=Klp98A PE=1 SV=2
18	PDB:4zjaA	0.124	0.575	1.265E-2	106	0.031	0.170	4zjaA.pdb.gz
19	PDB:6f2rA	0.114	0.435	1.788E-2	130	0.024	0.108	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
20	PDB:7oa6B	0.111	0.376	7.485E-2	152	0.028	0.105	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PI26	0.0	1191	577	1.000	1.000	SHQ1_HUMAN Protein SHQ1 homolog OS=Homo sapiens OX=9606 GN=SHQ1 PE=1 SV=2
2	O43076	9.60e-76	249	451	0.269	0.344	SHQ1_SCHPO Protein shq1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=shq1 PE=3 SV=1
3	P40486	1.82e-47	175	507	0.203	0.231	SHQ1_YEAST Protein SHQ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SHQ1 PE=1 SV=1
4	Q381E9	9.76e-21	98.2	565	0.109	0.112	Q381E9_TRYB2 Shq1 protein domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8060 PE=3 SV=1
5	Q61200	0.068	38.1	271	0.059	0.125	NXPH1_MOUSE Neurexophilin-1 OS=Mus musculus OX=10090 GN=Nxph1 PE=2 SV=2
6	Q9UL62	1.6	34.3	973	0.047	0.028	TRPC5_HUMAN Short transient receptor potential channel 5 OS=Homo sapiens OX=9606 GN=TRPC5 PE=1 SV=1
7	Q1MT86	5.2	32.7	853	0.036	0.025	Q1MT86_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fa06b05 PE=1 SV=1
8	Q4V973	5.2	32.3	834	0.036	0.025	Q4V973_DANRE Ubiquitin carboxyl-terminal hydrolase OS=Danio rerio OX=7955 GN=wu:fc21h02 PE=1 SV=1
9	Q9BRR0	5.4	32.3	538	0.042	0.045	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
10	Q0WMT6	5.9	32.3	631	0.050	0.046	Q0WMT6_ARATH ARM-repeat/Tetratricopeptide repeat (TPR)-like protein OS=Arabidopsis thaliana OX=3702 GN=SAV4 PE=1 SV=1
11	Q5UU75	7.4	32.0	440	0.026	0.034	DMTA2_DANRE Doublesex- and mab-3-related transcription factor A2 OS=Danio rerio OX=7955 GN=dmrta2 PE=2 SV=1
12	Q9UKV5	7.9	32.0	643	0.045	0.040	AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2
13	F4JTD2	9.5	31.6	821	0.066	0.046	F4JTD2_ARATH Putative rRNA methyltransferase OS=Arabidopsis thaliana OX=3702 GN=TRM7B PE=1 SV=1
14	Q57XW2	9.8	31.6	947	0.038	0.023	Q57XW2_TRYB2 Cullin 4B, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.1J15.620 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04925 SHQ1	5.2e-68	239.7	SHQ1 protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315182

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358563	0.999	H/ACA ribonucleoprotein complex subunit 4
2	9606.ENSP00000226796	0.990	H/ACA ribonucleoprotein complex subunit 1
3	9606.ENSP00000332198	0.987	H/ACA ribonucleoprotein complex subunit 3
4	9606.ENSP00000274606	0.984	H/ACA ribonucleoprotein complex subunit 2
5	9606.ENSP00000318297	0.931	RuvB-like 1
6	9606.ENSP00000473172	0.908	RuvB-like 2
7	9606.ENSP00000298746	0.818	Probable tRNA pseudouridine synthase 1
8	9606.ENSP00000264279	0.811	Nucleolar protein 58
9	9606.ENSP00000274054	0.787	H/ACA ribonucleoprotein complex non-core subunit NAF1
10	9606.ENSP00000370589	0.767	Nucleolar protein 56
11	9606.ENSP00000383949	0.764	NHP2-like protein 1
12	9606.ENSP00000335153	0.731	Heat shock protein HSP 90-alpha
13	9606.ENSP00000468057	0.728	Heat shock protein beta-6
14	9606.ENSP00000005386	0.718	RNA polymerase II-associated protein 3
15	9606.ENSP00000263666	0.694	E3 ubiquitin-protein ligase PDZRN3
16	9606.ENSP00000345295	0.688	SH2 domain containing 4B
17	9606.ENSP00000402505	0.688	C3 and PZP like, alpha-2-macroglobulin domain containing 8
18	9606.ENSP00000217173	0.685	RING finger protein 37
19	9606.ENSP00000313759	0.685	CST complex subunit CTC1
20	9606.ENSP00000386722	0.682	FCH and double SH3 domains 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0016043	0.986	cellular component organization
GO:0048523	0.976	negative regulation of cellular process
GO:0019219	0.975	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.972	positive regulation of biological process
GO:0010468	0.972	regulation of gene expression
GO:0065003	0.969	protein-containing complex assembly
GO:0048522	0.963	positive regulation of cellular process
GO:0022618	0.953	ribonucleoprotein complex assembly
GO:0010605	0.947	negative regulation of macromolecule metabolic process
GO:0032879	0.897	regulation of localization
GO:0010941	0.874	regulation of cell death
GO:0051252	0.874	regulation of RNA metabolic process
GO:0044087	0.827	regulation of cellular component biogenesis
GO:0010942	0.765	positive regulation of cell death
GO:0051172	0.754	negative regulation of nitrogen compound metabolic process
GO:0043067	0.647	regulation of programmed cell death
GO:0031324	0.604	negative regulation of cellular metabolic process
GO:0045934	0.472	negative regulation of nucleobase-containing compound metabolic process
GO:0042981	0.385	regulation of apoptotic process
GO:0071704	0.377	organic substance metabolic process
GO:1904874	0.372	positive regulation of telomerase RNA localization to Cajal body
GO:0006807	0.323	nitrogen compound metabolic process
GO:0043170	0.313	macromolecule metabolic process
GO:0051253	0.301	negative regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.557	intracellular non-membrane-bounded organelle
GO:0032991	0.498	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]