StarFunc result for job id Q6PI48

User Input

>input (645 residues)
MYFPSWLSQLYRGLSRPIRRTTQPIWGSLYRSLLQSSQRRIPEFSSFVVRTNTCGELRSS
HLGQEVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSG
TVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKKTEALRLQYRYLDLRS
FQMQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFYSLP
QSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGL
LQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDAL
SKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIME
SQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLW
VVDFPLFLPKEENPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGS
IRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRD
VIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PI48	1.000	1.000	0.000	645	1.000	1.000	Q6PI48.pdb.gz	SYDM_HUMAN Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1
2	AFDB:Q8BIP0	0.937	0.926	0.000	653	0.851	0.841	Q8BIP0.pdb.gz	SYDM_MOUSE Aspartate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Dars2 PE=1 SV=1
3	PDB:4ah6A	0.866	0.945	3.573E-95	589	0.913	1.000	4ah6A.pdb.gz
4	AFDB:Q9VJH2	0.881	0.532	2.029E-74	1082	0.431	0.257	Q9VJH2.pdb.gz	Q9VJH2_DROME Aspartyl-tRNA synthetase, mitochondrial, isoform A OS=Drosophila melanogaster OX=7227 GN=AspRS-m PE=1 SV=3
5	AFDB:F4JJT9	0.843	0.820	2.150E-66	664	0.375	0.364	F4JJT9.pdb.gz	SYDM_ARATH Aspartate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g33760 PE=2 SV=1
6	AFDB:P9WFW3	0.838	0.908	4.271E-65	594	0.363	0.394	P9WFW3.pdb.gz	SYDND_MYCTU Aspartate--tRNA(Asp/Asn) ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aspS PE=1 SV=1
7	AFDB:P21889	0.849	0.925	9.141E-65	590	0.375	0.410	P21889.pdb.gz	SYD_ECOLI Aspartate--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=aspS PE=1 SV=1
8	PDB:1eqrA	0.836	0.911	2.856E-62	590	0.377	0.412	1eqrA.pdb.gz
9	PDB:5w25A	0.821	0.905	4.566E-61	583	0.366	0.405	5w25A.pdb.gz	Crystal structure of Aspartyl-tRNA synthetase from Mycobacterium tuberculosis complexed with L-Aspartic Acid
10	AFDB:O94242	0.778	0.819	3.518E-58	611	0.347	0.367	O94242.pdb.gz	SYDM_SCHPO Aspartate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msd1 PE=3 SV=1
11	AFDB:P15179	0.754	0.740	1.068E-50	658	0.343	0.336	P15179.pdb.gz	SYDM_YEAST Aspartate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSD1 PE=1 SV=1
12	AFDB:Q8H104	0.549	0.660	8.727E-30	532	0.206	0.250	Q8H104.pdb.gz	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
13	AFDB:Q585M3	0.533	0.611	1.085E-29	560	0.198	0.229	Q585M3.pdb.gz	Q585M3_TRYB2 aspartate--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1030 PE=3 SV=1
14	PDB:6chdA	0.506	0.633	1.274E-27	506	0.166	0.211	6chdA.pdb.gz	Crystal Structure of Human Lysyl-tRNA Synthetase complexed with L-Lysylsulfamoyl Adenosine
15	PDB:1e1tA	0.510	0.666	2.446E-27	485	0.180	0.239	1e1tA.pdb.gz	Active Site of Lysyl-tRNA Synthetase: Structural Studies of the Adenylation Reaction
16	PDB:1bbuA	0.494	0.645	8.836E-26	486	0.177	0.235	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
17	PDB:4j15A	0.497	0.728	6.470E-24	431	0.166	0.248	4j15A.pdb.gz
18	PDB:5zg8A	0.475	0.709	1.483E-21	422	0.158	0.242	5zg8A.pdb.gz
19	PDB:3a5zC	0.323	0.621	2.526E-15	324	0.118	0.235	3a5zC.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.
20	PDB:3a5yA	0.314	0.658	1.410E-13	297	0.105	0.229	3a5yA.pdb.gz	A paralog of lysyl-tRNA synthetase aminoacylates a conserved lysine residue in translation elongation factor P.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ITK9	0.0	581	295	0.454	0.993	A0A3B3ITK9_HUMAN Aspartyl-tRNA synthetase 2, mitochondrial (Fragment) OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1
2	A0A3B3ITS3	0.0	931	482	0.695	0.929	A0A3B3ITS3_HUMAN Aspartyl-tRNA synthetase 2, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1
3	Q6PI48	0.0	1337	645	1.000	1.000	SYDM_HUMAN Aspartate--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=DARS2 PE=1 SV=1
4	Q8BIP0	0.0	1157	653	0.854	0.844	SYDM_MOUSE Aspartate--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Dars2 PE=1 SV=1
5	Q9VJH2	3.22e-178	536	1082	0.443	0.264	Q9VJH2_DROME Aspartyl-tRNA synthetase, mitochondrial, isoform A OS=Drosophila melanogaster OX=7227 GN=AspRS-m PE=1 SV=3
6	P21889	1.97e-145	436	590	0.375	0.410	SYD_ECOLI Aspartate--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=aspS PE=1 SV=1
7	P9WFW3	6.18e-137	415	594	0.371	0.402	SYDND_MYCTU Aspartate--tRNA(Asp/Asn) ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aspS PE=1 SV=1
8	F4JJT9	2.34e-136	416	664	0.386	0.375	SYDM_ARATH Aspartate--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g33760 PE=2 SV=1
9	O94242	1.26e-114	358	611	0.361	0.381	SYDM_SCHPO Aspartate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=msd1 PE=3 SV=1
10	P15179	3.25e-97	314	658	0.352	0.345	SYDM_YEAST Aspartate--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSD1 PE=1 SV=1
11	P0A8N3	1.14e-16	85.5	505	0.105	0.135	SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=lysS PE=1 SV=2
12	Q97RS9	1.33e-15	82.4	496	0.101	0.131	SYK_STRPN Lysine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=lysS PE=1 SV=2
13	Q22099	1.55e-15	82.4	572	0.076	0.086	SYK_CAEEL Lysine--tRNA ligase OS=Caenorhabditis elegans OX=6239 GN=kars-1 PE=3 SV=1
14	P0A8N5	8.71e-15	79.7	505	0.101	0.129	SYK2_ECOLI Lysine--tRNA ligase, heat inducible OS=Escherichia coli (strain K12) OX=83333 GN=lysU PE=1 SV=2
15	A0A140VJW5	1.63e-14	79.0	501	0.105	0.136	A0A140VJW5_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 PE=2 SV=1
16	P14868	1.63e-14	79.0	501	0.105	0.136	SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS1 PE=1 SV=2
17	Q8H104	3.17e-14	78.2	532	0.110	0.133	SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At4g26870 PE=2 SV=1
18	Q922B2	6.22e-14	77.0	501	0.102	0.132	SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Dars1 PE=1 SV=2
19	Q9M084	8.17e-14	77.0	558	0.121	0.140	SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=IBI1 PE=1 SV=1
20	Q5XIM7	1.66e-13	75.9	626	0.087	0.089	SYK_RAT Lysine--tRNA ligase OS=Rattus norvegicus OX=10116 GN=Kars1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02938 GAD	5.6e-10	50.7	GAD domain
2	PF00152 tRNA-synt_2	2.8e-90	314.2	tRNA synthetases class II (D, K and N)
3	PF01336 tRNA_anti-codon	1.8e-05	36.0	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355086

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000395196	0.930	Probable glutamate--tRNA ligase, mitochondrial
2	9606.ENSP00000358549	0.915	Probable arginine--tRNA ligase, mitochondrial
3	9606.ENSP00000472847	0.902	Serine--tRNA ligase, mitochondrial
4	9606.ENSP00000264161	0.888	Aspartate--tRNA ligase, cytoplasmic
5	9606.ENSP00000362576	0.888	Tyrosine--tRNA ligase, cytoplasmic
6	9606.ENSP00000261772	0.887	Alanine--tRNA ligase, cytoplasmic
7	9606.ENSP00000263985	0.885	Glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial
8	9606.ENSP00000355890	0.881	Bifunctional glutamate/proline--tRNA ligase
9	9606.ENSP00000244571	0.877	Alanine--tRNA ligase, mitochondrial
10	9606.ENSP00000320658	0.875	Tyrosine--tRNA ligase, mitochondrial
11	9606.ENSP00000282276	0.862	Methionine--tRNA ligase, mitochondrial
12	9606.ENSP00000408576	0.843	Probable leucine--tRNA ligase, mitochondrial
13	9606.ENSP00000364815	0.835	Valine--tRNA ligase
14	9606.ENSP00000355889	0.824	Isoleucine--tRNA ligase, mitochondrial
15	9606.ENSP00000441000	0.822	Valine--tRNA ligase, mitochondrial
16	9606.ENSP00000263629	0.811	Translation initiation factor IF-2, mitochondrial
17	9606.ENSP00000316335	0.810	Phenylalanine--tRNA ligase, mitochondrial
18	9606.ENSP00000373918	0.776	Glycine--tRNA ligase
19	9606.ENSP00000325448	0.771	Lysine--tRNA ligase
20	9606.ENSP00000360327	0.768	Probable proline--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042803	1.000	protein homodimerization activity
GO:0000049	1.000	tRNA binding
GO:0004812	1.000	aminoacyl-tRNA ligase activity
GO:0005524	1.000	ATP binding
GO:0004815	0.990	aspartate-tRNA ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043436	0.995	oxoacid metabolic process
GO:0034660	0.995	ncRNA metabolic process
GO:0006412	0.995	translation
GO:0006418	0.992	tRNA aminoacylation for protein translation
GO:0000959	0.902	mitochondrial RNA metabolic process
GO:0140053	0.853	mitochondrial gene expression
GO:0032543	0.802	mitochondrial translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005654	0.991	nucleoplasm
GO:0005759	0.895	mitochondrial matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.1.1.-	1.000	Ligases forming aminoacyl-tRNA and related compounds.
RHEA:19649	0.990	ATP + L-aspartate + tRNA(Asp) = AMP + diphosphate + L-aspartyl-tRNA(Asp)
EC:6.1.1.12	0.990	aspartate--tRNA ligase.

[back to server]