StarFunc result for job id Q6PI73

User Input

>input (481 residues)
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQL
DKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGF
YNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQAL
FPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQS
LTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAH
NLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEG
AAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSG
HSGGSSLPPTGPPSTPASHAKDYTVENLIRMGMAGLVLVFLGILLFEAQHSQRNPQDAAG
R

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O75022	0.877	0.671	2.708E-80	631	0.902	0.688	O75022.pdb.gz	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
2	AFDB:P59901	0.747	0.723	7.375E-67	499	0.703	0.677	P59901.pdb.gz	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
3	AFDB:Q8N149	0.770	0.767	7.034E-66	483	0.682	0.679	Q8N149.pdb.gz	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
4	AFDB:O75023	0.779	0.642	4.122E-63	590	0.657	0.536	O75023.pdb.gz	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
5	AFDB:O75019	0.745	0.734	3.077E-62	489	0.678	0.667	O75019.pdb.gz	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
6	AFDB:Q8NHL6	0.803	0.600	2.300E-60	650	0.647	0.478	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
7	AFDB:Q8N423	0.758	0.618	5.048E-59	598	0.642	0.517	Q8N423.pdb.gz	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
8	AFDB:Q8N6C8	0.771	0.839	4.163E-57	439	0.599	0.656	Q8N6C8.pdb.gz	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
9	AFDB:P97484	0.765	0.455	1.173E-52	841	0.497	0.284	P97484.pdb.gz	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	AFDB:P43630	0.532	0.561	2.412E-31	455	0.297	0.314	P43630.pdb.gz	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
11	PDB:7q1yA	0.157	0.072	7.796E-11	1374	0.131	0.046	7q1yA.pdb.gz
12	PDB:1e07A	0.179	0.146	3.743E-10	642	0.119	0.089	1e07A.pdb.gz
13	PDB:5oj2B	0.171	0.134	9.978E-10	692	0.135	0.094	5oj2B.pdb.gz
14	PDB:1hzhH	0.180	0.187	1.629E-9	457	0.125	0.131	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
15	PDB:1igaA	0.195	0.197	6.121E-9	475	0.141	0.143	1igaA.pdb.gz
16	PDB:4rtdA	0.169	0.086	7.822E-9	1122	0.104	0.045	4rtdA.pdb.gz
17	PDB:7vonA	0.171	0.078	8.627E-9	1399	0.110	0.038	7vonA.pdb.gz
18	PDB:4ziqA	0.164	0.071	1.341E-8	1450	0.108	0.036	4ziqA.pdb.gz
19	PDB:7q5zA	0.176	0.080	1.409E-8	1344	0.110	0.039	7q5zA.pdb.gz
20	PDB:7nycA	0.157	0.068	3.755E-8	1542	0.139	0.043	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O75019	0.0	599	489	0.684	0.673	LIRA1_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 1 OS=Homo sapiens OX=9606 GN=LILRA1 PE=2 SV=1
2	O75022	0.0	845	631	0.854	0.651	LIRB3_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Homo sapiens OX=9606 GN=LILRB3 PE=1 SV=3
3	O75023	0.0	591	590	0.642	0.524	LIRB5_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 5 OS=Homo sapiens OX=9606 GN=LILRB5 PE=1 SV=2
4	P59901	0.0	631	499	0.711	0.685	LIRA4_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 4 OS=Homo sapiens OX=9606 GN=LILRA4 PE=1 SV=3
5	Q8N149	0.0	609	483	0.692	0.689	LIRA2_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 2 OS=Homo sapiens OX=9606 GN=LILRA2 PE=1 SV=3
6	Q8N423	0.0	570	597	0.634	0.511	LIRB2_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 2 OS=Homo sapiens OX=9606 GN=LILRB2 PE=1 SV=5
7	Q8N6C8	0.0	550	439	0.595	0.651	LIRA3_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 3 OS=Homo sapiens OX=9606 GN=LILRA3 PE=1 SV=3
8	Q8NHL6	0.0	561	650	0.599	0.443	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
9	P97484	4.13e-142	430	841	0.476	0.272	LIRB3_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 3 OS=Mus musculus OX=10090 GN=Lilrb3 PE=1 SV=1
10	Q8K4V6	6.80e-140	420	697	0.476	0.329	Q8K4V6_MOUSE Paired immunoglobulin-like receptor B (Fragment) OS=Mus musculus OX=10090 GN=Pirb PE=1 SV=1
11	A6NI73	1.16e-107	323	299	0.335	0.538	LIRA5_HUMAN Leukocyte immunoglobulin-like receptor subfamily A member 5 OS=Homo sapiens OX=9606 GN=LILRA5 PE=1 SV=1
12	Q8NHJ6	8.67e-87	275	448	0.306	0.328	LIRB4_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 4 OS=Homo sapiens OX=9606 GN=LILRB4 PE=1 SV=3
13	Q8N743	6.74e-73	238	410	0.289	0.339	KI3L3_HUMAN Killer cell immunoglobulin-like receptor 3DL3 OS=Homo sapiens OX=9606 GN=KIR3DL3 PE=1 SV=2
14	P43630	1.82e-70	233	455	0.289	0.305	KI3L2_HUMAN Killer cell immunoglobulin-like receptor 3DL2 OS=Homo sapiens OX=9606 GN=KIR3DL2 PE=1 SV=1
15	P43629	2.47e-68	227	444	0.281	0.304	KI3L1_HUMAN Killer cell immunoglobulin-like receptor 3DL1 OS=Homo sapiens OX=9606 GN=KIR3DL1 PE=1 SV=1
16	Q14943	2.25e-67	223	382	0.291	0.366	KI3S1_HUMAN Killer cell immunoglobulin-like receptor 3DS1 OS=Homo sapiens OX=9606 GN=KIR3DS1 PE=1 SV=2
17	Q64281	3.21e-65	215	335	0.243	0.349	LRB4A_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4A OS=Mus musculus OX=10090 GN=Lilrb4a PE=1 SV=1
18	Q61450	5.26e-65	214	303	0.231	0.366	LRB4B_MOUSE Leukocyte immunoglobulin-like receptor subfamily B member 4B OS=Mus musculus OX=10090 GN=Lilrb4b PE=1 SV=1
19	Q28109	2.24e-55	187	264	0.212	0.386	Q28109_BOVIN FC gamma 2 receptor OS=Bos taurus OX=9913 PE=1 SV=1
20	Q8C567	7.27e-51	177	325	0.204	0.302	NCTR1_MOUSE Natural cytotoxicity triggering receptor 1 OS=Mus musculus OX=10090 GN=Ncr1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	83	14.7	Immunoglobulin I-set domain
2	PF00047 ig	2.9e-14	64.3	Immunoglobulin domain
3	PF13895 Ig_2	8.7e-26	101.4	Immunoglobulin domain
4	PF13927 Ig_3	4.8e-20	83.2	Immunoglobulin domain
5	PF07686 V-set	0.3	22.7	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351497	0.857	Low affinity immunoglobulin gamma Fc region receptor II-b
2	9606.ENSP00000433642	0.855	Low affinity immunoglobulin gamma Fc region receptor III-B
3	9606.ENSP00000356946	0.853	Low affinity immunoglobulin gamma Fc region receptor III-A
4	9606.ENSP00000412927	0.843	HLA class I histocompatibility antigen, alpha chain G
5	9606.ENSP00000358165	0.842	High affinity immunoglobulin gamma Fc receptor I
6	9606.ENSP00000271450	0.832	Low affinity immunoglobulin gamma Fc region receptor II-a
7	9606.ENSP00000365817	0.766	HLA class I histocompatibility antigen, alpha chain E
8	9606.ENSP00000379873	0.744	HLA class I histocompatibility antigen, A-3 alpha chain
9	9606.ENSP00000365402	0.713	HLA class I histocompatibility antigen, Cw-7 alpha chain
10	9606.ENSP00000399168	0.682	HLA class I histocompatibility antigen, B-7 alpha chain
11	9606.ENSP00000259951	0.676	HLA class I histocompatibility antigen, alpha chain F
12	9606.ENSP00000391592	0.674	Tyrosine-protein phosphatase non-receptor type 6
13	9606.ENSP00000340944	0.670	Tyrosine-protein phosphatase non-receptor type 11
14	9606.ENSP00000452780	0.670	Beta-2-microglobulin
15	9606.ENSP00000364907	0.669	Tyrosine-protein kinase SYK
16	9606.ENSP00000355995	0.619	Corticosteroid 11-beta-dehydrogenase isozyme 1
17	9606.ENSP00000371333	0.539	Natural killer cells antigen CD94
18	9606.ENSP00000438038	0.517	NKG2-A/NKG2-B type II integral membrane protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0038023	1.000	signaling receptor activity
GO:0005515	1.000	protein binding
GO:0004888	0.906	transmembrane signaling receptor activity
GO:0003823	0.881	antigen binding
GO:0044877	0.850	protein-containing complex binding
GO:0005102	0.755	signaling receptor binding
GO:0033218	0.309	amide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0007165	0.985	signal transduction
GO:0051239	0.978	regulation of multicellular organismal process
GO:0048583	0.974	regulation of response to stimulus
GO:0007166	0.958	cell surface receptor signaling pathway
GO:0019222	0.949	regulation of metabolic process
GO:0006950	0.940	response to stress
GO:0060255	0.936	regulation of macromolecule metabolic process
GO:0006952	0.932	defense response
GO:0048519	0.928	negative regulation of biological process
GO:0002682	0.927	regulation of immune system process
GO:0002764	0.894	immune response-regulating signaling pathway
GO:0031347	0.889	regulation of defense response
GO:0002376	0.884	immune system process
GO:0048518	0.879	positive regulation of biological process
GO:0001817	0.861	regulation of cytokine production
GO:0045088	0.843	regulation of innate immune response
GO:0032680	0.826	regulation of tumor necrosis factor production
GO:0048522	0.791	positive regulation of cellular process
GO:0002684	0.762	positive regulation of immune system process
GO:0048584	0.705	positive regulation of response to stimulus
GO:0048523	0.694	negative regulation of cellular process
GO:0002768	0.585	immune response-regulating cell surface receptor signaling pathway
GO:0032501	0.574	multicellular organismal process
GO:0050778	0.529	positive regulation of immune response
GO:0001819	0.524	positive regulation of cytokine production
GO:0002683	0.484	negative regulation of immune system process
GO:0006955	0.468	immune response
GO:0001775	0.423	cell activation
GO:0048585	0.418	negative regulation of response to stimulus
GO:0050865	0.407	regulation of cell activation
GO:0045089	0.379	positive regulation of innate immune response
GO:0032102	0.367	negative regulation of response to external stimulus
GO:0051249	0.360	regulation of lymphocyte activation
GO:0051241	0.359	negative regulation of multicellular organismal process
GO:0002703	0.356	regulation of leukocyte mediated immunity
GO:0002706	0.350	regulation of lymphocyte mediated immunity
GO:0044419	0.343	biological process involved in interspecies interaction between organisms
GO:0045321	0.342	leukocyte activation
GO:0009607	0.337	response to biotic stimulus
GO:0050867	0.335	positive regulation of cell activation
GO:0009605	0.331	response to external stimulus
GO:0009966	0.318	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.967	membrane-bounded organelle
GO:0012505	0.947	endomembrane system
GO:0043231	0.938	intracellular membrane-bounded organelle
GO:0031982	0.925	vesicle
GO:0005737	0.922	cytoplasm
GO:0032991	0.884	protein-containing complex
GO:0031090	0.875	organelle membrane
GO:0031410	0.871	cytoplasmic vesicle
GO:0030141	0.828	secretory granule
GO:0098588	0.818	bounding membrane of organelle
GO:0012506	0.795	vesicle membrane
GO:0030659	0.782	cytoplasmic vesicle membrane
GO:0005576	0.698	extracellular region
GO:0005615	0.659	extracellular space
GO:0098796	0.636	membrane protein complex
GO:0098797	0.472	plasma membrane protein complex
GO:0030667	0.441	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]