StarFunc result for job id Q6PI98

User Input

>input (192 residues)
MAAQIPIVATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISMEAMS
ENKMVPSEFSTGPVEKAAKPLPFKDPNFVHSGHGGAVAGKKNRTWKNLKQILASERALPW
QLNDPNYFSIDAPPSFKPAKKYSDVSGLLANYTDPQSKLRFSTIEEFSYIRRLPSDVVTG
YLALRKATSIVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PI98	1.000	1.000	8.199E-31	192	1.000	1.000	Q6PI98.pdb.gz	IN80C_HUMAN INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1
2	AFDB:Q8RWS0	0.463	0.687	8.214E-9	124	0.208	0.323	Q8RWS0.pdb.gz	EEN_ARATH Protein EIN6 ENHANCER OS=Arabidopsis thaliana OX=3702 GN=EEN PE=1 SV=1
3	AFDB:Q9M202	0.111	0.080	1.580E-1	288	0.125	0.083	Q9M202.pdb.gz	ZAT9_ARATH Zinc finger protein ZAT9 OS=Arabidopsis thaliana OX=3702 GN=ZAT9 PE=2 SV=1
4	AFDB:Q12983	0.142	0.110	2.547E-1	259	0.161	0.120	Q12983.pdb.gz	BNIP3_HUMAN BCL2/adenovirus E1B 19 kDa protein-interacting protein 3 OS=Homo sapiens OX=9606 GN=BNIP3 PE=1 SV=4
5	PDB:6htsR	0.184	0.432	4.218E-1	72	0.031	0.083	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
6	AFDB:Q585M4	0.129	0.071	9.303E-1	427	0.167	0.075	Q585M4.pdb.gz	Q585M4_TRYB2 Eukaryotic translation initiation factor 4E, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1010 PE=3 SV=1
7	AFDB:Q9BTK6	0.124	0.096	1.141	254	0.182	0.138	Q9BTK6.pdb.gz	PAGR1_HUMAN PAXIP1-associated glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=PAGR1 PE=1 SV=1
8	AFDB:Q9UEG4	0.121	0.032	1.141	869	0.146	0.032	Q9UEG4.pdb.gz	ZN629_HUMAN Zinc finger protein 629 OS=Homo sapiens OX=9606 GN=ZNF629 PE=1 SV=2
9	AFDB:Q99L02	0.121	0.097	1.222	253	0.161	0.123	Q99L02.pdb.gz	PGR1A_MOUSE PAXIP1-associated glutamate-rich protein 1A OS=Mus musculus OX=10090 GN=Pagr1a PE=1 SV=1
10	AFDB:Q9H0K4	0.124	0.040	1.222	717	0.177	0.047	Q9H0K4.pdb.gz	RSH6A_HUMAN Radial spoke head protein 6 homolog A OS=Homo sapiens OX=9606 GN=RSPH6A PE=1 SV=1
11	AFDB:Q9VHE3	0.115	0.065	1.308	448	0.161	0.069	Q9VHE3.pdb.gz	Q9VHE3_DROME GH05665p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9356 PE=1 SV=1
12	PDB:7abzX	0.135	0.272	2.483	77	0.057	0.143	7abzX.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
13	PDB:1sksA	0.090	0.035	5.627	681	0.057	0.016	1sksA.pdb.gz	Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
14	PDB:5o85D	0.152	0.424	5.627	53	0.026	0.094	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.
15	PDB:2g28B	0.105	0.031	6.024	801	0.021	0.005	2g28B.pdb.gz	A Thiamin-bound, Pre-decarboxylation Reaction Intermediate Analogue in the Pyruvate Dehydrogenase E1 Subunit Induces Large Scale Disorder-to-Order Transformations in the Enzyme and Reveals Novel Structural Features in the Covalently Bound Adduct.
16	PDB:6nwaY	0.079	0.054	6.024	340	0.031	0.018	6nwaY.pdb.gz	The structure of the stress-induced photosystem I-IsiA antenna supercomplex.
17	PDB:7uhyD	0.136	0.095	6.449	288	0.016	0.010	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:6bk8O	0.107	0.095	6.904	229	0.068	0.057	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
19	PDB:5xbtA	0.096	0.075	8.471	271	0.031	0.022	5xbtA.pdb.gz	BrlR from Pseudomonas aeruginosa is a receptor for both cyclic di-GMP and pyocyanin.
20	PDB:6fadC	0.086	0.052	8.471	359	0.026	0.014	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PI98	3.13e-140	390	192	1.000	1.000	IN80C_HUMAN INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1
2	Q8BHA0	1.78e-127	358	191	0.906	0.911	IN80C_MOUSE INO80 complex subunit C OS=Mus musculus OX=10090 GN=Ino80c PE=1 SV=1
3	Q9UTE8	7.61e-17	74.7	117	0.240	0.393	IES6_SCHPO Chromatin-remodeling complex subunit ies6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ies6 PE=3 SV=1
4	Q8RWS0	9.17e-17	74.7	124	0.203	0.315	EEN_ARATH Protein EIN6 ENHANCER OS=Arabidopsis thaliana OX=3702 GN=EEN PE=1 SV=1
5	P32617	2.40e-08	53.1	166	0.141	0.163	IES6_YEAST Chromatin-remodeling complex subunit IES6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IES6 PE=1 SV=1
6	Q9VDV4	0.27	34.3	1075	0.125	0.022	Q9VDV4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=2 SV=1
7	A0A0B4JCY1	0.28	34.3	1099	0.125	0.022	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
8	O14639	1.5	32.0	778	0.135	0.033	ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3
9	Q8LA13	2.8	31.2	612	0.099	0.031	RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana OX=3702 GN=RH11 PE=1 SV=1
10	Q8WMU5	5.5	30.0	712	0.135	0.037	FZD6_CANLF Frizzled-6 OS=Canis lupus familiaris OX=9615 GN=FZD6 PE=2 SV=1
11	O59669	5.6	29.3	139	0.083	0.115	VPS71_SCHPO SWR1 complex subunit vps71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps71 PE=1 SV=2
12	Q64511	7.0	30.0	1612	0.115	0.014	TOP2B_MOUSE DNA topoisomerase 2-beta OS=Mus musculus OX=10090 GN=Top2b PE=1 SV=2
13	Q9SHJ8	9.0	29.3	387	0.203	0.101	HIBC8_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=At1g06550 PE=1 SV=2
14	Q550F6	9.3	29.3	308	0.078	0.049	DCX_DICDI Protein doublecortin OS=Dictyostelium discoideum OX=44689 GN=dcx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16871 DUF5077	72	14.8	Domain of unknown function (DUF5077)
2	PF08265 YL1_C	1.7e-06	39.0	YL1 nuclear protein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000007604

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017307	0.995	RuvB-like helicase
2	61853.ENSNLEP00000007798	0.994	ARP5 actin-related protein 5 homolog (yeast)
3	61853.ENSNLEP00000004173	0.992	INO80 complex subunit
4	61853.ENSNLEP00000005920	0.991	RuvB-like helicase
5	61853.ENSNLEP00000008821	0.979	Actin-related protein 8
6	61853.ENSNLEP00000000734	0.963	annotation not available
7	61853.ENSNLEP00000009265	0.960	INO80 complex subunit E
8	61853.ENSNLEP00000007056	0.947	Actin-like 6A
9	61853.ENSNLEP00000007606	0.929	TCF3 (E2A) fusion partner (in childhood Leukemia)
10	61853.ENSNLEP00000017670	0.925	Chromodomain-helicase-DNA-binding protein 8
11	61853.ENSNLEP00000021653	0.925	Microspherule protein 1
12	61853.ENSNLEP00000021925	0.913	Ubiquitin carboxyl-terminal hydrolase L5
13	61853.ENSNLEP00000014397	0.908	Inhibitor of growth family, member 3
14	61853.ENSNLEP00000016316	0.908	WD repeat domain 5
15	61853.ENSNLEP00000007058	0.907	K(lysine) acetyltransferase 5
16	61853.ENSNLEP00000012347	0.904	Vacuolar protein sorting 72 homolog (S. cerevisiae)
17	61853.ENSNLEP00000014469	0.904	Actin-like 6B
18	61853.ENSNLEP00000017499	0.904	MYC associated factor X
19	61853.ENSNLEP00000004637	0.900	YEATS domain containing 4
20	61853.ENSNLEP00000016981	0.899	DNA methyltransferase 1 associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.987	positive regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0006355	0.980	regulation of DNA-templated transcription
GO:0051052	0.979	regulation of DNA metabolic process
GO:0045935	0.978	positive regulation of nucleobase-containing compound metabolic process
GO:0033044	0.977	regulation of chromosome organization
GO:0051726	0.976	regulation of cell cycle
GO:0010604	0.970	positive regulation of macromolecule metabolic process
GO:0006325	0.968	chromatin organization
GO:0051254	0.958	positive regulation of RNA metabolic process
GO:1902680	0.949	positive regulation of RNA biosynthetic process
GO:0006338	0.946	chromatin remodeling
GO:1903508	0.937	positive regulation of nucleic acid-templated transcription
GO:0045893	0.911	positive regulation of DNA-templated transcription
GO:0006275	0.713	regulation of DNA replication
GO:0071704	0.568	organic substance metabolic process
GO:0044238	0.565	primary metabolic process
GO:0006807	0.523	nitrogen compound metabolic process
GO:0043170	0.473	macromolecule metabolic process
GO:0044237	0.316	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031011	0.998	Ino80 complex
GO:0071339	0.997	MLL1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]