StarFunc result for job id Q6PIF6

User Input

>input (2116 residues)
MSGFRLGDHVWLEPPSTHKTGVAIGGIIKEAKPGKVLVEDDEGKEHWIRAEDFGVLSPMH
PNSVQGVDDMIRLGDLNEAGMVHNLLIRYQQHKIYTYTGSILVAVNPFQVLPLYTLEQVQ
LYYSRHMGELPPHVFAIANNCYFSMKRNKRDQCCIISGESGAGKTETTKLILQFLATISG
QHSWIEQQVLEANPILEAFGNAKTIRNDNSSRFGKYIDIYFNPSGVIEGARIEQFLLEKS
RVCRQAPEERNYHIFYCMLMGVSAEDKQLLSLGTPSEYHYLTMGNCTSCEGLNDAKDYAH
IRSAMKILQFSDSESWDVIKLLAAILHLGNVGFMASVFENLDASDVMETPAFPTVMKLLE
VQHQELRDCLIKHTILIRGEFVTRSLNIAQAADRRDAFVKGIYGHLFLWIVKKINAAIFT
PPAQDPKNVRRAIGLLDIFGFENFENNSFEQLCINFANEHLQQFFVQHVFTMEQEEYRSE
NISWDYIHYTDNRPTLDLLALKPMSIISLLDEESRFPQGTDLTMLQKLNSVHANNKAFLQ
PKNIHDARFGIAHFAGEVYYQAEGFLEKNRDVLSTDILTLVYSSKNKFLREIFNLELAET
KLGHGTIRQAKAGNHLFKSADSNKRPSTLGSQFKQSLDQLMKILTNCQPYFIRCIKPNEY
KKPLLFDRELCLRQLRYSGMMETVHIRKSGFPIRYTFEEFSQRFGVLLPNAMRMQLQGKL
RQMTLGITDVWLRTDKDWKAGKTKIFLRDHQDTLLEVQRSQVLDRAALSIQKVLRGYRYR
KEFLRQRRAAVTLQAWWRGYCNRRNFKLILVGFERLQAIARSQPLARQYQAMRQRTVQLQ
ALCRGYLVRQQVQAKRRAVVVIQAHARGMAARRNFQQRKANAPLVIPAEGQKSQGALPAK
KRRSIYDTVTDTEMVEKVFGFLPAMIGGQEGQASPHFEDLESKTQKLLEVDLDTVPMAEE
PEEDVDGLAEYTFPKFAVTYFQKSASHTHIRRPLRYPLLYHEDDTDCLAALVIWNVILRF
MGDLPEPVLYARSSQQGSSVMRQIHDTLGREHGAQVPQHSRSAQVASQLNIGEEALEPDG
LGADRPMSNLEKVHFIVGYAILRPSLRDEIYCQICKQLSENFKTSSLARGWILLSLCLGC
FPPSERFMKYLLNFIGQGPATYGPFCAERLRRTYANGVRAEPPTWLELQAVKSKKHIPIQ
VILATGESLTVPVDSASTSREMCMHIAHKQGLSDHLGFSLQVAVYDKFWSLGSGRDHMMD
AIARCEQMAQERGESQRQSPWRIYFRKEFFTPWHDSREDPVSTELIYRQVLRGVWSGEYS
FEKEEELVELLARHCYVQLGASAESKAVQELLPSCIPHKLYRTKPPDRWASLVTAACAKA
PYTQKQVTPLAVREQVVDAARLQWPLLFSRLFEVITLSGPRLPKTQLILAVNWKGLCFLD
QQEKMLLELSFPEVMGLATNREAQGGQRLLLSTMHEEYEFVSPSSVAIAELVALFLEGLK
ERSIFAMALQDRKATDDTTLLAFKKGDLLVLTKKQGLLASENWTLGQNDRTGKTGLVPMA
CLYTIPTVTKPSAQLLSLLAMSPEKRKLAAQEGQFTEPRPEEPPKEKLHTLEEFSYEFFR
APEKDMVSMAVLPLARARGHLWAYSCEPLRQPLLKRVHANVDLWDIACQIFVAILRYMGD
YPSRQAWPTLELTDQIFTLALQHPALQDEVYCQILKQLTHNSNRHSEERGWQLLWLCTGL
FPPSKGLLPHAQKFIDTRRGKLLAPDCSRRIQKVLRTGPRKQPPHQVEVEAAEQNVSRIC
HKIYFPNDTSEMLEVVANTRVRDVCDSIATRLQLASWEGCSLFIKISDKVISQKEGDFFF
DSLREVSDWVKKNKPQKEGAPVTLPYQVYFMRKLWLNISPGKDVNADTILHYHQELPKYL
RGFHKCSREDAIHLAGLIYKAQFNNDRSQLASVPKILRELVPENLTRLMSSEEWKKSILL
AYDKHKDKTVEEAKVAFLKWICRWPTFGSAFFEVKQTSEPSYPDVILIAINRHGVLLIHP
KTKDLLTTYPFTKISSWSSGSTYFHMALGSLGRGSRLLCETSLGYKMDDLLTSYVQQLLS
AMNKQRGSKAPALAST

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A286Y9F5	0.498	0.487	0.000	2190	0.538	0.520	A0A286Y9F5.pdb.gz
2	AFDB:P91443	0.500	0.504	0.000	2098	0.445	0.449	P91443.pdb.gz	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
3	AFDB:P97479	0.378	0.362	0.000	2215	0.545	0.521	P97479.pdb.gz	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
4	AFDB:Q6PIF6	1.000	1.000	0.000	2116	1.000	1.000	Q6PIF6.pdb.gz	MYO7B_HUMAN Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B PE=1 SV=2
5	AFDB:Q8CJE3	0.364	0.356	0.000	2177	0.540	0.525	Q8CJE3.pdb.gz	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
6	AFDB:Q8IPH8	0.363	0.362	0.000	2122	0.400	0.399	Q8IPH8.pdb.gz	Q8IPH8_DROME Myosin 28B1, isoform B OS=Drosophila melanogaster OX=7227 GN=Myo28B1 PE=3 SV=1
7	AFDB:Q99MZ6	0.730	0.731	0.000	2113	0.817	0.818	Q99MZ6.pdb.gz	MYO7B_MOUSE Unconventional myosin-VIIb OS=Mus musculus OX=10090 GN=Myo7b PE=1 SV=3
8	AFDB:Q9U1M8	0.333	0.301	0.000	2357	0.277	0.249	Q9U1M8.pdb.gz	MYOI_DICDI Myosin-I heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoI PE=1 SV=1
9	AFDB:Q9V3Z6	0.469	0.459	0.000	2167	0.493	0.482	Q9V3Z6.pdb.gz	MYO7A_DROME Myosin-VIIa OS=Drosophila melanogaster OX=7227 GN=ck PE=1 SV=1
10	AFDB:F8VQB6	0.340	0.348	1.045E-81	2062	0.241	0.247	F8VQB6.pdb.gz	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
11	PDB:4anjA	0.293	0.601	9.046E-51	995	0.127	0.270	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
12	PDB:4pa0B	0.300	0.660	1.253E-50	920	0.129	0.296	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0A	0.293	0.613	1.416E-50	974	0.129	0.279	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:6ycxB	0.304	0.745	2.452E-47	817	0.114	0.295	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
15	PDB:4p7hB	0.293	0.629	1.734E-46	952	0.126	0.280	4p7hB.pdb.gz
16	PDB:7mf3B	0.314	0.690	1.354E-40	896	0.140	0.331	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.296	0.610	6.770E-39	954	0.140	0.311	5tbyA.pdb.gz
18	PDB:4rm8A	0.114	0.538	7.563E-9	368	0.021	0.122	4rm8A.pdb.gz
19	PDB:7c3mA	0.107	0.347	3.935E-5	577	0.022	0.081	7c3mA.pdb.gz
20	PDB:6r9tA	0.077	0.074	1.283E-4	2185	0.021	0.021	6r9tA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MQX1	608	2069	0.155	0.159	A0A0A0MQX1_HUMAN Myosin X OS=Homo sapiens OX=9606 GN=MYO10 PE=1 SV=1
2	A0A0G2JTE7	629	3494	0.194	0.117	A0A0G2JTE7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
3	A0A0G2K1F7	632	3512	0.196	0.118	A0A0G2K1F7_RAT Myosin XVA OS=Rattus norvegicus OX=10116 GN=Myo15a PE=3 SV=2
4	A0A8I5ZWB0	2363	2238	0.545	0.515	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
5	A0A8J8XYU9	2351	2215	0.545	0.521	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
6	B0CN59	596	1512	0.164	0.229	B0CN59_NICBE Myosin XI-2 OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
7	B0CN60	607	1569	0.163	0.220	B0CN60_NICBE Myosin XI-F OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
8	B0CN61	613	1529	0.168	0.232	B0CN61_NICBE Myosin XI-K OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
9	F4HWY6	596	1529	0.169	0.234	MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 GN=XI-E PE=3 SV=1
10	F4HXP9	601	1538	0.165	0.227	MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana OX=3702 GN=XI-C PE=2 SV=1
11	F4I460	595	1500	0.165	0.233	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
12	F4IRU3	600	1556	0.166	0.226	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1
13	F4JM19	609	1516	0.172	0.240	MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana OX=3702 GN=XI-H PE=3 SV=1
14	F4K5J1	602	1531	0.165	0.228	MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2
15	F4K7C5	597	1565	0.167	0.226	F4K7C5_ARATH Myosin 2 OS=Arabidopsis thaliana OX=3702 GN=MYA2 PE=1 SV=1
16	F8VQB6	622	2062	0.155	0.160	MYO10_MOUSE Unconventional myosin-X OS=Mus musculus OX=10090 GN=Myo10 PE=1 SV=1
17	I3ITL5	628	2041	0.157	0.163	I3ITL5_DANRE Myosin X,-like 1 OS=Danio rerio OX=7955 GN=myo10l1 PE=3 SV=1
18	P79114	623	2052	0.158	0.163	MYO10_BOVIN Unconventional myosin-X OS=Bos taurus OX=9913 GN=MYO10 PE=1 SV=1
19	P91443	1820	2098	0.453	0.457	HUM6_CAEEL Unconventional myosin heavy chain 6 OS=Caenorhabditis elegans OX=6239 GN=hum-6 PE=1 SV=1
20	P97479	2361	2215	0.550	0.526	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.3e+02	13.5	AAA ATPase domain
2	PF13401 AAA_22	69	15.2	AAA domain
3	PF13604 AAA_30	1.8e+02	13.3	AAA domain
4	PF00005 ABC_tran	2.3e+02	13.7	ABC transporter
5	PF00373 FERM_M	6.2e-17	73.5	FERM central domain
6	PF00612 IQ	2.5e-11	53.3	IQ calmodulin-binding motif
7	PF00063 Myosin_head	9.8e-235	792.5	Myosin head (motor domain)
8	PF00784 MyTH4	8.5e-55	195.1	MyTH4 domain
9	PF00018 SH3_1	2.8	19.0	SH3 domain
10	PF07653 SH3_2	0.15	23.2	Variant SH3 domain
11	PF14604 SH3_9	0.0078	27.4	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000005226	0.991	Harmonin
2	9606.ENSP00000308772	0.959	Ankyrin repeat and SAM domain-containing protein 4B
3	9606.ENSP00000424565	0.840	Cadherin-related family member 2
4	9606.ENSP00000351118	0.810	Cadherin-related family member 5
5	9606.ENSP00000363068	0.689	Protocadherin-15
6	9606.ENSP00000480489	0.657	PDZ domain-containing protein 7
7	9606.ENSP00000371577	0.642	Myotubularin-related protein 12
8	9606.ENSP00000326888	0.583	LIM and senescent cell antigen-like-containing domain protein 2
9	9606.ENSP00000362186	0.580	Protocadherin-11 X-linked
10	9606.ENSP00000316891	0.576	LIM and calponin homology domains 1
11	9606.ENSP00000381768	0.560	Cadherin-23
12	9606.ENSP00000354623	0.541	Whirlin
13	9606.ENSP00000265339	0.532	Ubiquitin-conjugating enzyme E2 B
14	9606.ENSP00000360613	0.532	Ubiquitin-conjugating enzyme E2 A
15	9606.ENSP00000380517	0.532	Cadherin-24
16	9606.ENSP00000480279	0.525	Usher syndrome type-1G protein
17	9606.ENSP00000345972	0.514	FYN-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008092	0.874	cytoskeletal protein binding
GO:0140657	0.779	ATP-dependent activity
GO:0000146	0.654	microfilament motor activity
GO:0003779	0.579	actin binding
GO:0044877	0.398	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0071840	0.893	cellular component organization or biogenesis
GO:0016043	0.883	cellular component organization
GO:0022607	0.683	cellular component assembly
GO:0032501	0.595	multicellular organismal process
GO:0065007	0.541	biological regulation
GO:0050789	0.489	regulation of biological process
GO:0050794	0.427	regulation of cellular process
GO:0032502	0.362	developmental process
GO:0048856	0.348	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0120025	0.997	plasma membrane bounded cell projection
GO:0098862	0.986	cluster of actin-based cell projections
GO:0098858	0.985	actin-based cell projection
GO:0043226	0.970	organelle
GO:0043229	0.920	intracellular organelle
GO:0005737	0.834	cytoplasm
GO:0043227	0.829	membrane-bounded organelle
GO:0043232	0.803	intracellular non-membrane-bounded organelle
GO:0032991	0.774	protein-containing complex
GO:0016020	0.686	membrane
GO:0015629	0.597	actin cytoskeleton
GO:0071944	0.585	cell periphery
GO:0005902	0.557	microvillus
GO:0005903	0.497	brush border
GO:0043231	0.376	intracellular membrane-bounded organelle
GO:0005829	0.334	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.654	myosin ATPase.

[back to server]