StarFunc result for job id Q6PII5

User Input

>input (290 residues)
MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHA
RGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRFGAIHVRCLLTPGHTAGHMSYFLW
EDDCPDPPALFSGDALSVAGCGSCLEGSAQQMYQSLAELGTLPPETKVFCGHEHTLSNLE
FAQKVEPCNDHVRAKLSWAKARPLSRRGKRVGGEGTGFGVGGALRQGLMVTGACGHSRRG
MRMTCPLCRRLWARSASTTPSCGWREYGCCPGASTVTWTLRKASGDCVLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PII5	1.000	1.000	2.639E-61	290	1.000	1.000	Q6PII5.pdb.gz	HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens OX=9606 GN=HAGHL PE=1 SV=1
2	AFDB:Q5ZI23	0.690	0.646	1.211E-29	310	0.362	0.339	Q5ZI23.pdb.gz	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
3	AFDB:O35952	0.677	0.636	2.835E-29	309	0.362	0.340	O35952.pdb.gz	GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hagh PE=1 SV=2
4	AFDB:Q16775	0.675	0.636	1.754E-28	308	0.359	0.338	Q16775.pdb.gz	GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2
5	AFDB:O24496	0.698	0.784	1.233E-26	258	0.310	0.349	O24496.pdb.gz	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
6	AFDB:C0H490	0.683	0.752	2.017E-25	263	0.259	0.285	C0H490.pdb.gz	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
7	AFDB:Q8IPU3	0.689	0.576	2.017E-25	348	0.310	0.259	Q8IPU3.pdb.gz	Q8IPU3_DROME Tenzing norgay, isoform C OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
8	AFDB:A0A024R415	0.682	0.517	1.263E-22	385	0.300	0.226	A0A024R415.pdb.gz
9	AFDB:Q9SID3	0.648	0.582	9.381E-22	324	0.259	0.231	Q9SID3.pdb.gz	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
10	AFDB:O94250	0.644	0.726	2.333E-21	256	0.231	0.262	O94250.pdb.gz	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
11	PDB:6rz0A	0.655	0.754	3.012E-20	251	0.245	0.283	6rz0A.pdb.gz	Crystal structure of Escherichia coli Glyoxalase II
12	PDB:4chlB	0.525	0.635	2.319E-13	237	0.169	0.207	4chlB.pdb.gz	Crystal structure of human persulfide dioxygenase: structural basis of ethylmalonic encephalopathy.
13	PDB:4ad9A	0.491	0.494	5.527E-10	288	0.141	0.142	4ad9A.pdb.gz	Identification of Lactb2, a Metallo-Beta-Lactamase Protein, as a Human Mitochondrial Endoribonuclease
14	PDB:5evdA	0.463	0.500	3.029E-9	267	0.166	0.180	5evdA.pdb.gz	Cross-class metallo-beta-lactamase inhibition by bisthiazolidines reveals multiple binding modes.
15	PDB:3adrA	0.414	0.460	1.992E-8	259	0.176	0.197	3adrA.pdb.gz	The first crystal structure of an archaeal metallo-beta-lactamase superfamily protein; ST1585 from Sulfolobus tokodaii
16	PDB:1m2xA	0.424	0.542	8.055E-8	219	0.152	0.201	1m2xA.pdb.gz	The 1.5 A structure of Chryseobacterium meningosepticum Zn-beta-lactamase in complex with the inhibitor, D-captopril
17	PDB:4uwpB	0.422	0.516	8.559E-8	230	0.128	0.161	4uwpB.pdb.gz	Structural and Biochemical Characterization of Vim-26 Show that Leu224 Has Implications for the Substrate Specificity of Vim Metallo-Beta-Lactamases.
18	PDB:6jkaC	0.444	0.550	9.665E-8	228	0.148	0.189	6jkaC.pdb.gz	Identification of the Inhibitory Compounds for Metallo-beta-lactamases and Structural Analysis of the Binding Modes.
19	PDB:2q0jA	0.439	0.415	3.462E-7	310	0.159	0.148	2q0jA.pdb.gz	Structure elucidation and preliminary assessment of hydrolase activity of PqsE, the Pseudomonas quinolone signal (PQS) response protein.
20	PDB:4hl2A	0.435	0.510	3.462E-7	243	0.100	0.119	4hl2A.pdb.gz	New Delhi Metallo-beta-Lactamase-1 1.05 A structure Complexed with Hydrolyzed Ampicillin

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PII5	0.0	592	290	1.000	1.000	HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens OX=9606 GN=HAGHL PE=1 SV=1
2	Q5ZI23	4.89e-76	236	310	0.366	0.342	GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus OX=9031 GN=HAGH PE=2 SV=1
3	O35952	4.87e-74	231	309	0.369	0.346	GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Hagh PE=1 SV=2
4	Q99KB8	1.50e-73	229	309	0.366	0.343	GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus OX=10090 GN=Hagh PE=1 SV=2
5	Q16775	4.96e-73	228	308	0.366	0.344	GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HAGH PE=1 SV=2
6	Q9I7P8	1.86e-60	195	271	0.314	0.336	Q9I7P8_DROME Tenzing norgay, isoform B OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
7	Q9VPB3	2.40e-60	196	305	0.314	0.298	Q9VPB3_DROME LD26447p OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=2
8	Q8IPU3	1.80e-59	195	348	0.314	0.261	Q8IPU3_DROME Tenzing norgay, isoform C OS=Drosophila melanogaster OX=7227 GN=tzn PE=1 SV=1
9	O24496	2.77e-54	179	258	0.310	0.349	GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=GLX2-2 PE=1 SV=2
10	C0H490	5.05e-47	160	263	0.252	0.278	C0H490_PLAF7 Cytosolic glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0406400 PE=3 SV=1
11	Q8N490	1.92e-43	154	385	0.300	0.226	PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens OX=9606 GN=PNKD PE=1 SV=2
12	Q69ZP3	6.18e-41	147	385	0.290	0.218	PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus OX=10090 GN=Pnkd PE=1 SV=2
13	Q9SID3	5.66e-39	141	324	0.248	0.222	GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At2g31350 PE=1 SV=1
14	Q8LDW8	1.21e-36	135	331	0.252	0.221	GLO2D_ARATH Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GLX2-4 PE=2 SV=1
15	O24495	3.36e-36	134	331	0.248	0.218	GLO2M_ARATH Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GLX2-1 PE=2 SV=2
16	O94250	2.41e-29	114	256	0.234	0.266	GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC13B11.03c PE=3 SV=1
17	Q9UT36	1.35e-27	109	256	0.210	0.238	GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC824.07 PE=3 SV=1
18	P0AC84	2.26e-26	105	251	0.255	0.295	GLO2_ECOLI Hydroxyacylglutathione hydrolase GloB OS=Escherichia coli (strain K12) OX=83333 GN=gloB PE=1 SV=1
19	Q8I5Y8	2.42e-24	102	322	0.193	0.174	Q8I5Y8_PLAF7 Targeted glyoxalase II OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1205700 PE=3 SV=1
20	Q05584	1.48e-23	99.0	274	0.200	0.212	GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GLO2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16123 HAGH_C	0.32	22.8	Hydroxyacylglutathione hydrolase C-terminus
2	PF00753 Lactamase_B	2.1e-07	42.7	Metallo-beta-lactamase superfamily
3	PF12706 Lactamase_B_2	0.68	21.0	Beta-lactamase superfamily domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013595

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000014864	0.697	4-hydroxy-2-oxoglutarate aldolase 1
2	9593.ENSGGOP00000016222	0.653	Zinc finger protein 775
3	9593.ENSGGOP00000010371	0.648	Lactate dehydrogenase D
4	9593.ENSGGOP00000020410	0.648	Lactoylglutathione lyase
5	9593.ENSGGOP00000021201	0.648	Methylmalonyl CoA epimerase
6	9593.ENSGGOP00000011565	0.639	Glycerol-3-phosphate dehydrogenase 1 (soluble)
7	9593.ENSGGOP00000013937	0.623	D-2-hydroxyglutarate dehydrogenase
8	9593.ENSGGOP00000020967	0.567	HDGF like 2
9	9593.ENSGGOP00000024884	0.546	Phosphoacetylglucosamine mutase
10	9593.ENSGGOP00000015133	0.534	Uncharacterized protein
11	9593.ENSGGOP00000019957	0.505	Phosphatidylinositol-5-phosphate 4-kinase, type II, gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.995	catalytic activity
GO:0016788	0.923	hydrolase activity, acting on ester bonds
GO:0004416	0.482	hydroxyacylglutathione hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.836	metabolic process
GO:0065007	0.769	biological regulation
GO:0050789	0.489	regulation of biological process
GO:0071704	0.465	organic substance metabolic process
GO:0050794	0.457	regulation of cellular process
GO:0009987	0.306	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.974	intracellular organelle lumen
GO:0005634	0.965	nucleus
GO:0005829	0.914	cytosol
GO:0031981	0.762	nuclear lumen
GO:0005654	0.754	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.923	Acting on ester bonds.
RHEA:25245	0.482	(R)-S-lactoylglutathione + H2O = (R)-lactate + glutathione + H(+)
EC:3.1.2.6	0.482	hydroxyacylglutathione hydrolase.

[back to server]