StarFunc result for job id Q6PIJ6

User Input

>input (1188 residues)
MGPRKKSVKTCIMNNEIPEEMTADETKDYMNQLSHEVLCHIFRYLPLQDIMCMECLSRKL
KEAVTLYLRVVRVVDLCAGRWWEYMPSGFTDASFLTLLKKMPDVEQLYGLHPRYLERRRV
RGHEAFSIPGVLEALQACPNLVGVETSHLELVESIWTYMPHVHILGKFRNRNGAFPIPPE
NKLKIPIGAKIQTLHLVGVNVPEIPCIPMLRHLYMKWVRLTKPQPFKDFLCISLRTFVMR
NCAGPTNSLKYVPLVTGLASARNLEHLEMVRVPFLGGLIQHVVEDSWRSGGFRNLHTIVL
GACKNALEVDLGYLIITAARRLHEVRIQPSLTKDGVFSALKMAELEFPQFETLHLGYVDE
FLLQSRMANADLVKYGLADVVENPGIITDIGMKAVNEVFSCIKYLAIYNCPHLHNPYNWI
SDHSRWTRLVDINLVRCHALKLDSFGQFIELLPSLEFISLDQMFREPPKGCARVGLSAGT
GIGVSSALVSNQNSNNDDNNAQNNNANIHDNNHHHPDDSDEENDFRQDLQPGEQQFAADA
LNEMEDIVQEDGEVVAESGNNTPAHSQAIIPVDVDEEQAGPSGLQRVVKPTSITVHDSES
DDEEDSLELQEVWIPKNGTRRYSEREEKTGESVQSRELSVSGKGKTPLRKRYNSHQMGQS
KQFPLEESSCEKGCQVTSEQIKADMKAARDIPEKKKNKDVYPSCSSTTASTVGNSSSHNT
ASQSPDFVRTVNSGGSSEPSPTEVDVSRQCACSPGGSEDSEAMEEGDAESSVCPRCCCHR
PQESQRRTSRCSDEERPSTSRACVVNGPDGTRSAFSFRTLPQGGSSGPAHDERTNGSGSG
ATGEDRRGSSQPESCDVQSNEDYPRRPLTRARSRLSHVLLVSESEVAKTKPRHAMKRKRT
ADKSTSTSDPVIEDDHVQVLVLKSKNLVGVTMTNCGITDLVLKDCPKMMFIHATRCRVLK
HLKVENAPIVNRFDYAQCKKLNMDQVLDQILRMPPERNRIIYLRPMQQVDTLTLEQKLFS
GPYPYHICIIHEFSNPPNVRNKVRIRSWMDTIANINQELIKYEFFPEATRSEEDLKKYPK
YPWGREIYTLEGVVDGAPYSMISDFPWLRSLRAAEPNSFARYDFEDDEESTIYAPRRKGQ
LSADICMETIGEEISEMRQMKKGVFQRVVAIFIHYCDVNGEPVEDDYI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BMI0	0.712	0.708	0.000	1194	0.943	0.938	Q8BMI0.pdb.gz	FBX38_MOUSE F-box only protein 38 OS=Mus musculus OX=10090 GN=Fbxo38 PE=1 SV=1
2	PDB:6o60C	0.163	0.364	9.141E-8	389	0.046	0.141	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
3	PDB:2p1nB	0.143	0.241	4.527E-7	571	0.055	0.114	2p1nB.pdb.gz	Mechanism of auxin perception by the TIR1 ubiquitin ligase
4	PDB:7sa1B	0.157	0.236	7.271E-6	624	0.065	0.123	7sa1B.pdb.gz
5	PDB:3oglB	0.161	0.287	1.618E-5	568	0.060	0.125	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
6	AFDB:Q96NW7	0.169	0.137	2.083E-5	1537	0.104	0.081	Q96NW7.pdb.gz	LRRC7_HUMAN Leucine-rich repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=LRRC7 PE=1 SV=1
7	AFDB:P70587	0.177	0.147	1.368E-4	1490	0.114	0.091	P70587.pdb.gz	LRRC7_RAT Leucine-rich repeat-containing protein 7 OS=Rattus norvegicus OX=10116 GN=Lrrc7 PE=1 SV=2
8	PDB:7b5mT	0.135	0.398	1.870E-4	325	0.041	0.151	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
9	AFDB:Q96RT1	0.173	0.150	2.089E-4	1412	0.093	0.078	Q96RT1.pdb.gz	ERBIN_HUMAN Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2
10	PDB:1a4yA	0.168	0.358	3.288E-4	460	0.046	0.120	1a4yA.pdb.gz
11	AFDB:Q80TH2	0.173	0.150	3.675E-4	1402	0.093	0.078	Q80TH2.pdb.gz	ERBIN_MOUSE Erbin OS=Mus musculus OX=10090 GN=Erbin PE=1 SV=3
12	PDB:4i6jB	0.127	0.275	5.264E-4	394	0.052	0.157	4i6jB.pdb.gz
13	PDB:5hywA	0.158	0.258	6.661E-4	580	0.054	0.110	5hywA.pdb.gz
14	PDB:5hzgB	0.158	0.256	6.982E-4	615	0.045	0.086	5hzgB.pdb.gz	DWARF14 is a non-canonical hormone receptor for strigolactone
15	PDB:7pmkL	0.207	0.424	9.705E-4	475	0.056	0.141	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
16	AFDB:M0R9T2	0.106	0.100	1.041E-1	1258	0.083	0.079	M0R9T2.pdb.gz	M0R9T2_RAT Erbb2 interacting protein OS=Rattus norvegicus OX=10116 GN=Erbin PE=1 SV=3
17	AFDB:Q8ND23	0.161	0.144	1.203	1372	0.114	0.098	Q8ND23.pdb.gz	CARL3_HUMAN Capping protein, Arp2/3 and myosin-I linker protein 3 OS=Homo sapiens OX=9606 GN=CARMIL3 PE=2 SV=2
18	AFDB:P16112	0.069	0.043	2.678	2530	0.096	0.045	P16112.pdb.gz	PGCA_HUMAN Aggrecan core protein OS=Homo sapiens OX=9606 GN=ACAN PE=1 SV=3
19	AFDB:Q86SJ6	0.032	0.035	6.246	1040	0.058	0.066	Q86SJ6.pdb.gz	DSG4_HUMAN Desmoglein-4 OS=Homo sapiens OX=9606 GN=DSG4 PE=1 SV=1
20	AFDB:O65655	0.030	0.051	7.193	633	0.055	0.103	O65655.pdb.gz	O65655_ARATH SAP domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At4g39680 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PIJ6	0.0	2484	1188	1.000	1.000	FBX38_HUMAN F-box only protein 38 OS=Homo sapiens OX=9606 GN=FBXO38 PE=1 SV=3
2	Q8BMI0	0.0	2189	1194	0.937	0.932	FBX38_MOUSE F-box only protein 38 OS=Mus musculus OX=10090 GN=Fbxo38 PE=1 SV=1
3	Q7Z5P9	0.41	37.7	8384	0.036	0.005	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
4	Q99LC8	1.4	35.0	305	0.028	0.108	EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus OX=10090 GN=Eif2b1 PE=1 SV=1
5	Q22875	1.5	35.4	559	0.028	0.059	SHOC2_CAEEL Leucine-rich repeat protein soc-2 OS=Caenorhabditis elegans OX=6239 GN=soc-2 PE=1 SV=3
6	O09046	4.9	33.9	630	0.017	0.032	OXLA_MOUSE L-amino-acid oxidase OS=Mus musculus OX=10090 GN=Il4i1 PE=1 SV=1
7	Q28615	6.1	33.5	593	0.016	0.032	S13A2_RABIT Solute carrier family 13 member 2 OS=Oryctolagus cuniculus OX=9986 GN=SLC13A2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.82	20.9	F-box domain
2	PF12937 F-box-like	8.7	17.6	F-box-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000029716

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000021975	0.715	Kruppel-like factor 7 (Ubiquitous)
2	9598.ENSPTRP00000033967	0.706	Cullin-1
3	9598.ENSPTRP00000048665	0.696	F-box protein 36
4	9598.ENSPTRP00000000406	0.695	F-box protein 42
5	9598.ENSPTRP00000032129	0.695	Uncharacterized protein
6	9598.ENSPTRP00000034149	0.695	Testis development related protein
7	9598.ENSPTRP00000052649	0.690	F-box protein 34
8	9598.ENSPTRP00000058732	0.690	F-box protein 16
9	9598.ENSPTRP00000059359	0.689	F-box protein 8
10	9598.ENSPTRP00000005096	0.671	F-box and leucine-rich repeat protein 15
11	9598.ENSPTRP00000053032	0.671	Pan troglodytes F-box protein 47 (FBXO47), mRNA
12	9598.ENSPTRP00000003388	0.667	F-box protein 28
13	9598.ENSPTRP00000058985	0.654	MON2 homolog
14	9598.ENSPTRP00000027160	0.588	F-box protein 45
15	9598.ENSPTRP00000030254	0.588	PAK1 interacting protein 1
16	9598.ENSPTRP00000031586	0.560	Cell division cycle 40 homolog
17	9598.ENSPTRP00000017377	0.540	AP-3 complex subunit delta
18	9598.ENSPTRP00000006355	0.537	Uncharacterized protein
19	9598.ENSPTRP00000017776	0.505	F-box and leucine-rich repeat protein 12
20	9598.ENSPTRP00000038444	0.504	Uncharacterized protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.303	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0009987	0.985	cellular process
GO:0019538	0.985	protein metabolic process
GO:0070647	0.974	protein modification by small protein conjugation or removal
GO:0044237	0.973	cellular metabolic process
GO:0016567	0.909	protein ubiquitination
GO:0044260	0.900	cellular macromolecule metabolic process
GO:0050794	0.893	regulation of cellular process
GO:0006511	0.803	ubiquitin-dependent protein catabolic process
GO:0043161	0.792	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0048518	0.756	positive regulation of biological process
GO:0048583	0.721	regulation of response to stimulus
GO:0048522	0.719	positive regulation of cellular process
GO:0031146	0.649	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0000209	0.499	protein polyubiquitination
GO:0048584	0.353	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.985	cytoplasm
GO:0032991	0.983	protein-containing complex
GO:0005634	0.981	nucleus
GO:0000151	0.919	ubiquitin ligase complex
GO:0031461	0.884	cullin-RING ubiquitin ligase complex
GO:0019005	0.872	SCF ubiquitin ligase complex
GO:0070013	0.437	intracellular organelle lumen
GO:0031981	0.422	nuclear lumen
GO:0005829	0.328	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]