StarFunc result for job id Q6PIZ9

User Input

>input (186 residues)
MSGISGCPFFLWGLLALLGLALVISLIFNISHYVEKQRQDKMYSYSSDHTRVDEYYIEDT
PIYGNLDDMISEPMDENCYEQMKARPEKSVNKMQEATPSAQATNETQMCYASLDHSVKGK
RRKPRKQNTHFSDKDGDEQLHAIDASVSKTTLVDSFSPESQAVEENIHDDPIRLFGLIRA
KREPIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PIZ9	1.000	1.000	1.480E-29	186	1.000	1.000	Q6PIZ9.pdb.gz	TRAT1_HUMAN T-cell receptor-associated transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=TRAT1 PE=1 SV=1
2	AFDB:Q9Y5G9	0.244	0.051	4.504E-1	962	0.129	0.025	Q9Y5G9.pdb.gz	PCDG4_HUMAN Protocadherin gamma-A4 OS=Homo sapiens OX=9606 GN=PCDHGA4 PE=1 SV=2
3	AFDB:B2RXR7	0.198	0.037	5.584E-1	1161	0.167	0.027	B2RXR7.pdb.gz	B2RXR7_MOUSE Pcdh9 protein OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
4	AFDB:O60500	0.238	0.044	6.443E-1	1241	0.151	0.023	O60500.pdb.gz	NPHN_HUMAN Nephrin OS=Homo sapiens OX=9606 GN=NPHS1 PE=1 SV=1
5	AFDB:Q91XY7	0.236	0.059	6.443E-1	932	0.108	0.021	Q91XY7.pdb.gz	Q91XY7_MOUSE Protocadherin gamma A12 OS=Mus musculus OX=10090 GN=Pcdhga12 PE=1 SV=1
6	AFDB:Q91XZ0	0.191	0.054	6.921E-1	931	0.145	0.029	Q91XZ0.pdb.gz	Q91XZ0_MOUSE Protocadherin gamma A1 OS=Mus musculus OX=10090 GN=Pcdhga1 PE=1 SV=1
7	AFDB:O94898	0.217	0.051	9.217E-1	1065	0.194	0.034	O94898.pdb.gz	LRIG2_HUMAN Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=1 SV=3
8	AFDB:O19131	0.205	0.097	1.064	471	0.145	0.057	O19131.pdb.gz	TNR1A_BOVIN Tumor necrosis factor receptor superfamily member 1A OS=Bos taurus OX=9913 GN=TNFRSF1A PE=2 SV=1
9	AFDB:Q9CXH7	0.138	0.058	1.064	517	0.177	0.064	Q9CXH7.pdb.gz	SGO1_MOUSE Shugoshin 1 OS=Mus musculus OX=10090 GN=Sgo1 PE=2 SV=1
10	AFDB:Q8H125	0.139	0.046	1.143	597	0.145	0.045	Q8H125.pdb.gz	SCL5_ARATH Scarecrow-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=SCL5 PE=1 SV=1
11	PDB:7ajtUN	0.158	0.194	6.796	147	0.065	0.082	7ajtUN.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PIZ9	2.23e-141	392	186	1.000	1.000	TRAT1_HUMAN T-cell receptor-associated transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=TRAT1 PE=1 SV=1
2	C9JF66	8.85e-109	309	149	0.790	0.987	C9JF66_HUMAN T cell receptor associated transmembrane adaptor 1 OS=Homo sapiens OX=9606 GN=TRAT1 PE=1 SV=1
3	Q9Y3P8	0.28	33.5	196	0.151	0.143	SIT1_HUMAN Signaling threshold-regulating transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=SIT1 PE=1 SV=1
4	Q8H991	1.3	32.0	792	0.134	0.032	HAZ1_ORYSJ Homeobox protein HAZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=HAZ1 PE=2 SV=1
5	Q92337	2.0	31.6	1427	0.134	0.018	ABC1_SCHPO ATP-binding cassette transporter abc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abc1 PE=3 SV=1
6	Q9ERF3	2.0	31.2	305	0.172	0.105	SKI8_MOUSE Superkiller complex protein 8 OS=Mus musculus OX=10090 GN=Skic8 PE=1 SV=1
7	F4K1J4	2.2	31.2	1423	0.113	0.015	ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana OX=3702 GN=ATXR7 PE=2 SV=1
8	H0YN81	2.5	30.8	294	0.097	0.061	H0YN81_HUMAN SKI8 subunit of superkiller complex (Fragment) OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
9	Q96TA1	2.7	31.2	746	0.086	0.021	NIBA2_HUMAN Protein Niban 2 OS=Homo sapiens OX=9606 GN=NIBAN2 PE=1 SV=3
10	Q9GZS3	2.7	30.8	305	0.118	0.072	SKI8_HUMAN Superkiller complex protein 8 OS=Homo sapiens OX=9606 GN=SKIC8 PE=1 SV=1
11	Q6P978	3.8	30.4	303	0.070	0.043	Q6P978_DANRE Elongation of very long chain fatty acids protein 4 OS=Danio rerio OX=7955 GN=elovl4 PE=2 SV=1
12	F1QL52	4.1	30.4	4219	0.091	0.004	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
13	A8VKP8	4.3	30.4	4218	0.091	0.004	A8VKP8_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
14	G5EAX6	6.9	29.6	599	0.048	0.015	G5EAX6_EMENI FAD-binding FR-type domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07662 PE=4 SV=1
15	A0A1D8PPX8	8.7	29.3	332	0.118	0.066	A0A1D8PPX8_CANAL Sec20p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC20 PE=4 SV=1
16	D6RFI4	9.4	29.3	290	0.102	0.066	D6RFI4_HUMAN Paired like homeodomain 2 (Fragment) OS=Homo sapiens OX=9606 GN=PITX2 PE=1 SV=1
17	P70314	9.9	28.9	315	0.086	0.051	PITX1_MOUSE Pituitary homeobox 1 OS=Mus musculus OX=10090 GN=Pitx1 PE=2 SV=2
18	Q18221	9.9	29.3	1507	0.102	0.013	SET2_CAEEL Histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans OX=6239 GN=set-2 PE=1 SV=2
19	Q9PWR3	10.0	29.3	326	0.102	0.058	PITX2_XENLA Pituitary homeobox 2 OS=Xenopus laevis OX=8355 GN=pitx2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05279 Asp-B-Hydro_N	4.1e+02	12.2	Aspartyl beta-hydroxylase N-terminal region
2	PF15330 SIT	1.1e-30	117.8	SHP2-interacting transmembrane adaptor protein, SIT

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354782	0.986	T-cell surface glycoprotein CD3 zeta chain
2	9606.ENSP00000300692	0.975	T-cell surface glycoprotein CD3 delta chain
3	9606.ENSP00000354566	0.965	T-cell surface glycoprotein CD3 epsilon chain
4	9606.ENSP00000264972	0.952	Tyrosine-protein kinase ZAP-70
5	9606.ENSP00000431445	0.948	T-cell surface glycoprotein CD3 gamma chain
6	9606.ENSP00000011653	0.947	T-cell surface glycoprotein CD4
7	9606.ENSP00000260970	0.937	Peptidyl-prolyl cis-trans isomerase G
8	9606.ENSP00000263182	0.937	Gamma-butyrobetaine dioxygenase
9	9606.ENSP00000386559	0.937	T-cell surface glycoprotein CD8 alpha chain
10	9606.ENSP00000331172	0.927	T-cell surface glycoprotein CD8 beta chain
11	9606.ENSP00000364907	0.921	Tyrosine-protein kinase SYK
12	9606.ENSP00000406970	0.880	Lymphocyte transmembrane adapter 1
13	9606.ENSP00000303939	0.875	Cytotoxic T-lymphocyte protein 4
14	9606.ENSP00000355658	0.865	E3 ubiquitin-protein ligase TRIM17
15	9606.ENSP00000369373	0.857	Tripartite motif-containing protein 5
16	9606.ENSP00000369213	0.832	Probable ATP-dependent RNA helicase DDX58
17	9606.ENSP00000323889	0.805	E3 ubiquitin/ISG15 ligase TRIM25
18	9606.ENSP00000422947	0.778	Tripartite motif containing 34
19	9606.ENSP00000433623	0.777	TNF receptor-associated factor 6
20	9606.ENSP00000369299	0.771	E3 ubiquitin-protein ligase TRIM22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005068	1.000	transmembrane receptor protein tyrosine kinase adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050896	0.998	response to stimulus
GO:0050794	0.998	regulation of cellular process
GO:0050776	0.992	regulation of immune response
GO:0023051	0.987	regulation of signaling
GO:0010646	0.987	regulation of cell communication
GO:0048518	0.986	positive regulation of biological process
GO:0006952	0.981	defense response
GO:1902531	0.981	regulation of intracellular signal transduction
GO:0048584	0.980	positive regulation of response to stimulus
GO:0048519	0.979	negative regulation of biological process
GO:0023056	0.979	positive regulation of signaling
GO:0010647	0.979	positive regulation of cell communication
GO:0051716	0.974	cellular response to stimulus
GO:0007154	0.973	cell communication
GO:0009967	0.972	positive regulation of signal transduction
GO:0023052	0.963	signaling
GO:0048523	0.953	negative regulation of cellular process
GO:0007165	0.950	signal transduction
GO:0019222	0.948	regulation of metabolic process
GO:1902533	0.932	positive regulation of intracellular signal transduction
GO:0060255	0.929	regulation of macromolecule metabolic process
GO:0031323	0.923	regulation of cellular metabolic process
GO:0002684	0.903	positive regulation of immune system process
GO:0050778	0.827	positive regulation of immune response
GO:0009892	0.825	negative regulation of metabolic process
GO:0050854	0.812	regulation of antigen receptor-mediated signaling pathway
GO:0050848	0.803	regulation of calcium-mediated signaling
GO:0010605	0.779	negative regulation of macromolecule metabolic process
GO:0006968	0.743	cellular defense response
GO:0050850	0.654	positive regulation of calcium-mediated signaling
GO:0032879	0.505	regulation of localization
GO:0031324	0.493	negative regulation of cellular metabolic process
GO:0051049	0.468	regulation of transport
GO:0023057	0.385	negative regulation of signaling
GO:0051051	0.316	negative regulation of transport
GO:0050856	0.311	regulation of T cell receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0072686	1.000	mitotic spindle
GO:0034451	0.999	centriolar satellite
GO:0032991	0.991	protein-containing complex
GO:0043227	0.815	membrane-bounded organelle
GO:0098796	0.812	membrane protein complex
GO:0043231	0.800	intracellular membrane-bounded organelle
GO:0043235	0.792	receptor complex
GO:0005737	0.783	cytoplasm
GO:0042101	0.761	T cell receptor complex
GO:0005829	0.391	cytosol
GO:0012505	0.351	endomembrane system
GO:0005634	0.346	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]