StarFunc result for job id Q6PJ69

User Input

>input (517 residues)
MAAQLLEEKLTCAICLGLYQDPVTLPCGHNFCGACIRDWWDRCGKACPECREPFPDGAEL
RRNVALSGVLEVVRAGPARDPGPDPGPGPDPAARCPRHGRPLELFCRTEGRCVCSVCTVR
ECRLHERALLDAERLKREAQLRASLEVTQQQATQAEGQLLELRKQSSQIQNSACILASWV
SGKFSSLLQALEIQHTTALRSIEVAKTQALAQARDEEQRLRVHLEAVARHGCRIRELLEQ
VDEQTFLQESQLLQPPGPLGPLTPLQWDEDQQLGDLKQLLSRLCGLLLEEGSHPGAPAKP
VDLAPVEAPGPLAPVPSTVCPLRRKLWQNYRNLTFDPVSANRHFYLSRQDQQVKHCRQSR
GPGGPGSFELWQVQCAQSFQAGHHYWEVRASDHSVTLGVSYPQLPRCRLGPHTDNIGRGP
CSWGLCVQEDSLQAWHNGEAQRLPGVSGRLLGMDLDLASGCLTFYSLEPQTQPLYTFHAL
FNQPLTPVFWLLEGRTLTLCHQPGAVFPLGPQEEVLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJ69	1.000	1.000	9.137E-100	517	1.000	1.000	Q6PJ69.pdb.gz	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
2	AFDB:Q61510	0.331	0.271	8.424E-39	634	0.267	0.218	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
3	AFDB:Q14258	0.331	0.273	6.934E-38	630	0.269	0.221	Q14258.pdb.gz	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
4	AFDB:D4A9N5	0.332	0.268	1.539E-37	643	0.265	0.213	D4A9N5.pdb.gz	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
5	AFDB:A0A0R4IKI3	0.334	0.265	1.826E-37	654	0.279	0.220	A0A0R4IKI3.pdb.gz
6	AFDB:F1QZK7	0.328	0.257	8.033E-37	664	0.292	0.227	F1QZK7.pdb.gz
7	AFDB:A2BFT4	0.336	0.304	2.240E-36	573	0.259	0.234	A2BFT4.pdb.gz
8	AFDB:Q923T7	0.329	0.333	8.791E-36	510	0.246	0.249	Q923T7.pdb.gz	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
9	AFDB:Q9C029	0.333	0.337	1.844E-35	511	0.265	0.268	Q9C029.pdb.gz	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
10	AFDB:A0A060IVL7	0.307	0.293	5.190E-33	548	0.250	0.235	A0A060IVL7.pdb.gz	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
11	PDB:7y4sA	0.308	0.458	2.946E-18	343	0.172	0.259	7y4sA.pdb.gz
12	PDB:4b3nA	0.292	0.272	5.357E-12	557	0.075	0.070	4b3nA.pdb.gz	Structural Insight Into HIV-1 Capsid Recognition by Rhesus Trim5Alpha
13	PDB:7ccbA	0.256	0.734	6.119E-8	164	0.054	0.171	7ccbA.pdb.gz
14	PDB:7nscA	0.268	0.475	9.117E-8	276	0.060	0.112	7nscA.pdb.gz
15	PDB:7z36B	0.221	0.252	3.380E-7	446	0.093	0.108	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
16	PDB:6swy1	0.228	0.219	2.628E-6	542	0.056	0.054	6swy1.pdb.gz
17	PDB:7nsba	0.219	0.201	7.328E-6	568	0.062	0.056	7nsba.pdb.gz
18	PDB:7m6aA	0.197	0.027	1.031E-5	4306	0.052	0.006	7m6aA.pdb.gz	High-resolution structure of the membrane-embedded skeletal muscle ryanodine receptor.
19	PDB:6venO	0.203	0.317	3.045E-5	315	0.068	0.111	6venO.pdb.gz	Structural basis for COMPASS recognition of an H2B-ubiquitinated nucleosome.
20	PDB:7ua3A	0.198	0.026	3.223E-5	4443	0.041	0.005	7ua3A.pdb.gz	Structural analyses of human ryanodine receptor type 2 channels reveal the mechanisms for sudden cardiac death and treatment.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0YG27	0.0	558	288	0.553	0.993	H0YG27_HUMAN Tripartite motif containing 65 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=1
2	Q6PJ69	0.0	1041	517	1.000	1.000	TRI65_HUMAN E3 ubiquitin-protein ligase TRIM65 OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=3
3	H0YGS7	6.73e-169	478	244	0.462	0.980	H0YGS7_HUMAN Tripartite motif containing 65 (Fragment) OS=Homo sapiens OX=9606 GN=TRIM65 PE=1 SV=1
4	Q08CC1	1.19e-46	173	573	0.275	0.248	Q08CC1_DANRE FinTRIM family, member 82 OS=Danio rerio OX=7955 GN=si:dkey-252h13.6 PE=1 SV=1
5	Q61510	3.78e-32	132	634	0.279	0.227	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
6	Q14258	1.52e-31	130	630	0.284	0.233	TRI25_HUMAN E3 ubiquitin/ISG15 ligase TRIM25 OS=Homo sapiens OX=9606 GN=TRIM25 PE=1 SV=2
7	E7F8P0	4.76e-28	119	548	0.257	0.243	E7F8P0_DANRE Tripartite motif-containing 69 OS=Danio rerio OX=7955 GN=rnf36 PE=4 SV=1
8	Q9C029	1.04e-27	118	511	0.263	0.266	TRIM7_HUMAN E3 ubiquitin-protein ligase TRIM7 OS=Homo sapiens OX=9606 GN=TRIM7 PE=1 SV=2
9	A0A060IVL7	1.38e-27	118	548	0.255	0.241	A0A060IVL7_DANRE Tripartite motif containing 69 protein OS=Danio rerio OX=7955 GN=TRIM69 PE=2 SV=1
10	Q3UWZ0	2.24e-27	117	467	0.234	0.259	TRI75_MOUSE Tripartite motif-containing protein 75 OS=Mus musculus OX=10090 GN=Trim75 PE=1 SV=1
11	A0A024RCP5	6.02e-26	113	518	0.244	0.243	A0A024RCP5_HUMAN TRIM39 OS=Homo sapiens OX=9606 PE=4 SV=1
12	Q9HCM9	6.02e-26	113	518	0.244	0.243	TRI39_HUMAN E3 ubiquitin-protein ligase TRIM39 OS=Homo sapiens OX=9606 GN=TRIM39 PE=1 SV=2
13	Q96F44	2.82e-25	110	468	0.308	0.340	TRI11_HUMAN E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11 PE=1 SV=2
14	Q923T7	3.05e-25	111	510	0.277	0.280	TRIM7_MOUSE E3 ubiquitin-protein ligase TRIM7 OS=Mus musculus OX=10090 GN=Trim7 PE=2 SV=2
15	Q7ZVQ7	5.80e-25	111	654	0.153	0.121	Q7ZVQ7_DANRE E3 ubiquitin/ISG15 ligase TRIM25 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
16	A0A2R8QTG3	1.56e-24	109	645	0.151	0.121	A0A2R8QTG3_DANRE E3 ubiquitin/ISG15 ligase TRIM25 isoform X1 OS=Danio rerio OX=7955 GN=zgc:55773 PE=1 SV=1
17	Q8VI40	3.35e-24	107	466	0.248	0.275	TRI60_MOUSE E3 SUMO-protein ligase TRIM60 OS=Mus musculus OX=10090 GN=Trim60 PE=1 SV=1
18	Q9C037	3.13e-23	105	500	0.265	0.274	TRIM4_HUMAN E3 ubiquitin-protein ligase TRIM4 OS=Homo sapiens OX=9606 GN=TRIM4 PE=1 SV=2
19	A0A1U9X8R9	6.19e-23	104	513	0.246	0.248	A0A1U9X8R9_HUMAN RING-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 PE=4 SV=2
20	P14373	6.19e-23	104	513	0.246	0.248	TRI27_HUMAN Zinc finger protein RFP OS=Homo sapiens OX=9606 GN=TRIM27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	35	15.7	Prokaryotic RING finger family 4
2	PF13765 PRY	2.6	19.1	SPRY-associated domain
3	PF00622 SPRY	0.0012	30.3	SPRY domain
4	PF04564 U-box	1.6e+02	13.9	U-box domain
5	PF00643 zf-B_box	0.071	24.6	B-box zinc finger
6	PF00097 zf-C3HC4	2.9e-07	41.6	Zinc finger, C3HC4 type (RING finger)
7	PF13923 zf-C3HC4_2	9.3e-05	33.5	Zinc finger, C3HC4 type (RING finger)
8	PF13920 zf-C3HC4_3	7.2e-05	33.9	Zinc finger, C3HC4 type (RING finger)
9	PF15227 zf-C3HC4_4	2.9e-05	35.4	zinc finger of C3HC4-type, RING
10	PF16685 zf-RING_10	42	15.7	zinc RING finger of MSL2
11	PF13639 zf-RING_2	0.0028	29.3	Ring finger domain
12	PF14570 zf-RING_4	21	16.3	RING/Ubox like zinc-binding domain
13	PF14634 zf-RING_5	1.4	20.2	zinc-RING finger domain
14	PF14835 zf-RING_6	3.4	18.9	zf-RING of BARD1-type protein
15	PF13445 zf-RING_UBOX	5.2e-06	37.7	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269383

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308275	0.702	Mitochondrial ribosomal protein L38
2	9606.ENSP00000269305	0.677	Cellular tumor antigen p53
3	9606.ENSP00000379144	0.623	Trinucleotide repeat-containing gene 6A protein
4	9606.ENSP00000324292	0.620	Fas-binding factor 1
5	9606.ENSP00000467579	0.595	WW domain-binding protein 2
6	9606.ENSP00000263642	0.587	Interferon-induced helicase C domain-containing protein 1
7	9606.ENSP00000295756	0.556	T-cell receptor-associated transmembrane adapter 1
8	9606.ENSP00000268042	0.551	Arrestin domain-containing protein 4
9	9606.ENSP00000336783	0.542	Trinucleotide repeat-containing gene 6C protein
10	9606.ENSP00000357259	0.537	Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis. May act as a cotranscription partner of NFE2L2 involved in regulation of polyamine-induced transcription of SSAT.
11	9606.ENSP00000450114	0.525	Uncharacterized protein CLBA1
12	9606.ENSP00000357256	0.504	Polyamine-modulated factor 1
13	9606.ENSP00000399903	0.501	Neurobeachin-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.995	ubiquitin-protein transferase activity
GO:0042802	0.793	identical protein binding
GO:0140110	0.624	transcription regulator activity
GO:0061630	0.545	ubiquitin protein ligase activity
GO:0003713	0.449	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0048522	0.982	positive regulation of cellular process
GO:0031329	0.868	regulation of cellular catabolic process
GO:0031331	0.846	positive regulation of cellular catabolic process
GO:0009987	0.778	cellular process
GO:0010506	0.725	regulation of autophagy
GO:0060255	0.714	regulation of macromolecule metabolic process
GO:0010508	0.704	positive regulation of autophagy
GO:0071704	0.615	organic substance metabolic process
GO:0044238	0.576	primary metabolic process
GO:0006807	0.558	nitrogen compound metabolic process
GO:0043170	0.518	macromolecule metabolic process
GO:0051171	0.472	regulation of nitrogen compound metabolic process
GO:0080090	0.456	regulation of primary metabolic process
GO:0050896	0.426	response to stimulus
GO:1901564	0.418	organonitrogen compound metabolic process
GO:0010468	0.411	regulation of gene expression
GO:0048583	0.378	regulation of response to stimulus
GO:0019538	0.377	protein metabolic process
GO:0032446	0.343	protein modification by small protein conjugation
GO:0009889	0.328	regulation of biosynthetic process
GO:0048519	0.320	negative regulation of biological process
GO:0019219	0.318	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.313	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.997	nucleoplasm
GO:0043232	0.337	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]