StarFunc result for job id Q6PJF5

User Input

>input (856 residues)
MASADKNGGSVSSVSSSRLQSRKPPNLSITIPPPEKETQAPGEQDSMLPEGFQNRRLKKS
QPRTWAAHTTACPPSFLPKRKNPAYLKSVSLQEPRSRWQESSEKRPGFRRQASLSQSIRK
GAAQWFGVSGDWEGQRQQWQRRSLHHCSMRYGRLKASCQRDLELPSQEAPSFQGTESPKP
CKMPKIVDPLARGRAFRHPEEMDRPHAPHPPLTPGVLSLTSFTSVRSGYSHLPRRKRMSV
AHMSLQAAAALLKGRSVLDATGQRCRVVKRSFAFPSFLEEDVVDGADTFDSSFFSKEEMS
SMPDDVFESPPLSASYFRGIPHSASPVSPDGVQIPLKEYGRAPVPGPRRGKRIASKVKHF
AFDRKKRHYGLGVVGNWLNRSYRRSISSTVQRQLESFDSHRPYFTYWLTFVHVIITLLVI
CTYGIAPVGFAQHVTTQLVLRNKGVYESVKYIQQENFWVGPSSIDLIHLGAKFSPCIRKD
GQIEQLVLRERDLERDSGCCVQNDHSGCIQTQRKDCSETLATFVKWQDDTGPPMDKSDLG
QKRTSGAVCHQDPRTCEEPASSGAHIWPDDITKWPICTEQARSNHTGFLHMDCEIKGRPC
CIGTKGSCEITTREYCEFMHGYFHEEATLCSQVHCLDKVCGLLPFLNPEVPDQFYRLWLS
LFLHAGVVHCLVSVVFQMTILRDLEKLAGWHRIAIIFILSGITGNLASAIFLPYRAEVGP
AGSQFGLLACLFVELFQSWPLLERPWKAFLNLSAIVLFLFICGLLPWIDNIAHIFGFLSG
LLLAFAFLPYITFGTSDKYRKRALILVSLLAFAGLFAALVLWLYIYPINWPWIEHLTCFP
FTSRFCEKYELDQVLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJF5	1.000	1.000	0.000	856	1.000	1.000	Q6PJF5.pdb.gz	RHDF2_HUMAN Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2 PE=1 SV=2
2	AFDB:Q76NQ1	0.489	0.297	7.465E-51	1429	0.285	0.171	Q76NQ1.pdb.gz	RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster OX=7227 GN=rho-5 PE=2 SV=1
3	PDB:2nr9A	0.142	0.546	8.418E-3	192	0.041	0.182	2nr9A.pdb.gz	The crystal structure of the rhomboid peptidase from Haemophilus influenzae provides insight into intramembrane proteolysis.
4	PDB:3odjA	0.116	0.559	5.100E-2	157	0.034	0.185	3odjA.pdb.gz
5	AFDB:P55937	0.042	0.026	3.747E-1	1487	0.068	0.039	P55937.pdb.gz	GOGA3_MOUSE Golgin subfamily A member 3 OS=Mus musculus OX=10090 GN=Golga3 PE=1 SV=3
6	AFDB:Q5APR8	0.054	0.050	7.077E-1	976	0.079	0.070	Q5APR8.pdb.gz	CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CLA4 PE=1 SV=1
7	AFDB:Q55FD8	0.072	0.041	1.486	1982	0.132	0.057	Q55FD8.pdb.gz	GEFV_DICDI Ras guanine nucleotide exchange factor V OS=Dictyostelium discoideum OX=44689 GN=gefV PE=2 SV=1
8	PDB:5voxP	0.072	0.110	1.514	462	0.035	0.065	5voxP.pdb.gz
9	PDB:5oglA	0.047	0.052	1.683	707	0.039	0.047	5oglA.pdb.gz	Molecular basis of lipid-linked oligosaccharide recognition and processing by bacterial oligosaccharyltransferase.
10	PDB:7rzwB	0.068	0.068	2.194	864	0.028	0.028	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
11	PDB:1dw9A	0.041	0.154	2.313	156	0.011	0.058	1dw9A.pdb.gz
12	AFDB:P18488	0.043	0.057	2.394	497	0.076	0.131	P18488.pdb.gz	EMS_DROME Homeotic protein empty spiracles OS=Drosophila melanogaster OX=7227 GN=ems PE=2 SV=2
13	AFDB:Q4ZJF0	0.041	0.073	2.394	349	0.058	0.143	Q4ZJF0.pdb.gz
14	AFDB:P58390	0.057	0.058	2.524	839	0.143	0.145	P58390.pdb.gz	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2
15	PDB:7nyhN	0.070	0.108	2.859	467	0.022	0.041	7nyhN.pdb.gz
16	AFDB:Q54RY6	0.053	0.080	3.468	467	0.040	0.073	Q54RY6.pdb.gz	SRFB_DICDI Serum response factor homolog B OS=Dictyostelium discoideum OX=44689 GN=srfB PE=3 SV=1
17	AFDB:Q58CJ5	0.044	0.043	3.468	899	0.070	0.067	Q58CJ5.pdb.gz	Q58CJ5_DROME GH01093p OS=Drosophila melanogaster OX=7227 GN=sals PE=1 SV=1
18	PDB:5kucA	0.050	0.094	3.534	402	0.025	0.052	5kucA.pdb.gz
19	PDB:7bssA	0.088	0.092	3.534	816	0.034	0.036	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
20	PDB:6xmtA	0.086	0.071	3.727	1092	0.028	0.022	6xmtA.pdb.gz	The endoplasmic reticulum P5A-ATPase is a transmembrane helix dislocase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PJF5	0.0	1770	856	1.000	1.000	RHDF2_HUMAN Inactive rhomboid protein 2 OS=Homo sapiens OX=9606 GN=RHBDF2 PE=1 SV=2
2	Q80WQ6	0.0	1562	827	0.888	0.919	RHDF2_MOUSE Inactive rhomboid protein 2 OS=Mus musculus OX=10090 GN=Rhbdf2 PE=1 SV=1
3	Q96CC6	0.0	935	855	0.582	0.582	RHDF1_HUMAN Inactive rhomboid protein 1 OS=Homo sapiens OX=9606 GN=RHBDF1 PE=1 SV=2
4	Q76NQ1	1.78e-119	396	1429	0.221	0.132	RHDF1_DROME Inactive rhomboid protein 1 OS=Drosophila melanogaster OX=7227 GN=rho-5 PE=2 SV=1
5	Q8I433	1.82e-22	105	759	0.071	0.080	Q8I433_PLAF7 rhomboid protease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0506900 PE=4 SV=1
6	Q9LYP1	9.22e-22	100	346	0.065	0.162	RBL3_ARATH RHOMBOID-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=RBL3 PE=2 SV=1
7	Q0WQX7	3.46e-21	99.0	389	0.081	0.177	RBL1_ARATH RHOMBOID-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=RBL1 PE=2 SV=1
8	F4JBM4	2.57e-20	96.3	394	0.076	0.165	RBL4_ARATH RHOMBOID-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=RBL4 PE=2 SV=1
9	Q9CAN1	2.99e-20	94.7	317	0.057	0.155	RBL2_ARATH RHOMBOID-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=RBL2 PE=1 SV=1
10	Q695T8	6.70e-17	87.8	641	0.054	0.072	RHBL4_TOXGO Rhomboid-like protease 4 OS=Toxoplasma gondii OX=5811 GN=ROM4 PE=2 SV=1
11	A0A1D8PFE0	1.39e-15	83.6	669	0.067	0.085	A0A1D8PFE0_CANAL Rbd1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RBD1 PE=4 SV=1
12	Q8IIM2	4.98e-11	66.6	278	0.046	0.140	Q8IIM2_PLAF7 rhomboid protease OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1114100.1 PE=4 SV=2
13	A0A0H2US45	2.06e-10	63.9	225	0.050	0.191	A0A0H2US45_STRPN Peptidase S54 rhomboid domain-containing protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_2094 PE=1 SV=1
14	Q9NX52	6.74e-06	51.2	303	0.034	0.096	RHBL2_HUMAN Rhomboid-related protein 2 OS=Homo sapiens OX=9606 GN=RHBDL2 PE=1 SV=2
15	Q9VYW6	2.13e-05	50.1	417	0.036	0.074	Q9VYW6_DROME Rhomboid-4 OS=Drosophila melanogaster OX=7227 GN=rho-4 PE=1 SV=2
16	P46116	5.13e-05	48.5	281	0.049	0.149	AARA_PROST Rhomboid protease AarA OS=Providencia stuartii OX=588 GN=aarA PE=1 SV=1
17	Q19821	6.86e-05	48.5	356	0.053	0.126	RHOM1_CAEEL Rhomboid-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=rom-1 PE=2 SV=2
18	Q9W0E9	1.17e-04	48.1	485	0.040	0.070	Q9W0E9_DROME Stem cell tumor, isoform B OS=Drosophila melanogaster OX=7227 GN=stet PE=4 SV=2
19	A2AGA4	1.41e-04	47.0	302	0.028	0.079	RHBL2_MOUSE Rhomboid-related protein 2 OS=Mus musculus OX=10090 GN=Rhbdl2 PE=1 SV=1
20	P20350	4.45e-04	45.8	355	0.047	0.113	RHOM_DROME Protein rhomboid OS=Drosophila melanogaster OX=7227 GN=rho PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01694 Rhomboid	8.1e-24	95.8	Rhomboid family
2	PF12595 Rhomboid_SP	9.3e-83	287.9	Rhomboid serine protease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322775

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309968	0.987	Disintegrin and metalloproteinase domain-containing protein 17
2	9606.ENSP00000295702	0.835	Translocon-associated protein subunit beta
3	9606.ENSP00000344206	0.827	Rhomboid-related protein 1
4	9606.ENSP00000392066	0.806	Disco-interacting protein 2 homolog A
5	9606.ENSP00000216085	0.788	Rhomboid domain containing 3
6	9606.ENSP00000293230	0.788	Cytoglobin
7	9606.ENSP00000375914	0.782	Rhomboid-related protein 4
8	9606.ENSP00000325421	0.767	Presenilins-associated rhomboid-like protein, mitochondrial
9	9606.ENSP00000265171	0.722	Pro-epidermal growth factor
10	9606.ENSP00000323687	0.713	(E3-independent) E2 ubiquitin-conjugating enzyme
11	9606.ENSP00000372482	0.707	Small nuclear ribonucleoprotein U11/U12 subunit 25
12	9606.ENSP00000382508	0.691	Cell death-inducing p53-target protein 1
13	9606.ENSP00000260408	0.686	Disintegrin and metalloproteinase domain-containing protein 10
14	9606.ENSP00000313681	0.666	Sphingosine kinase 1
15	9606.ENSP00000348050	0.665	Matrix-remodeling-associated protein 7
16	9606.ENSP00000305714	0.637	Bone morphogenetic protein 1
17	9606.ENSP00000250615	0.635	Serotonin N-acetyltransferase
18	9606.ENSP00000380762	0.624	CST complex subunit TEN1
19	9606.ENSP00000416683	0.598	Insulin-like growth factor-binding protein complex acid labile subunit
20	9606.ENSP00000312066	0.596	Signal recognition particle subunit SRP68

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140318	0.963	protein transporter activity
GO:0003824	0.480	catalytic activity
GO:0140096	0.473	catalytic activity, acting on a protein
GO:0016787	0.447	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.981	cellular process
GO:0019222	0.977	regulation of metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0080090	0.964	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0048523	0.961	negative regulation of cellular process
GO:0048583	0.941	regulation of response to stimulus
GO:0051246	0.936	regulation of protein metabolic process
GO:0032880	0.900	regulation of protein localization
GO:1903828	0.882	negative regulation of protein localization
GO:0080134	0.828	regulation of response to stress
GO:0030162	0.777	regulation of proteolysis
GO:0048585	0.756	negative regulation of response to stimulus
GO:0051049	0.743	regulation of transport
GO:0051051	0.711	negative regulation of transport
GO:0051223	0.696	regulation of protein transport
GO:1904950	0.677	negative regulation of establishment of protein localization
GO:0051224	0.671	negative regulation of protein transport
GO:0051046	0.663	regulation of secretion
GO:0050708	0.647	regulation of protein secretion
GO:0050709	0.640	negative regulation of protein secretion
GO:0065009	0.602	regulation of molecular function
GO:0002682	0.587	regulation of immune system process
GO:0032101	0.587	regulation of response to external stimulus
GO:0002683	0.551	negative regulation of immune system process
GO:0031347	0.529	regulation of defense response
GO:0050727	0.455	regulation of inflammatory response
GO:0051179	0.399	localization
GO:0050776	0.394	regulation of immune response
GO:0010646	0.379	regulation of cell communication
GO:0023051	0.365	regulation of signaling
GO:0008152	0.360	metabolic process
GO:0071704	0.347	organic substance metabolic process
GO:0032102	0.304	negative regulation of response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0005886	0.998	plasma membrane
GO:0070013	0.991	intracellular organelle lumen
GO:0005794	0.741	Golgi apparatus
GO:0031981	0.510	nuclear lumen
GO:0005654	0.376	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.447	Hydrolases.

[back to server]