StarFunc result for job id Q6PJG2

User Input

>input (1045 residues)
MNLQAQPKAQNKRKRCLFGGQEPAPKEQPPPLQPPQQSIRVKEEQYLGHEGPGGAVSTSQ
PVELPPPSSLALLNSVVYGPERTSAAMLSQQVASVKWPNSVMAPGRGPERGGGGGVSDSS
WQQQPGQPPPHSTWNCHSLSLYSATKGSPHPGVGVPTYYNHPEALKREKAGGPQLDRYVR
PMMPQKVQLEVGRPQAPLNSFHAAKKPPNQSLPLQPFQLAFGHQVNRQVFRQGPPPPNPV
AAFPPQKQQQQQQPQQQQQQQQAALPQMPLFENFYSMPQQPSQQPQDFGLQPAGPLGQSH
LAHHSMAPYPFPPNPDMNPELRKALLQDSAPQPALPQVQIPFPRRSRRLSKEGILPPSAL
DGAGTQPGQEATGNLFLHHWPLQQPPPGSLGQPHPEALGFPLELRESQLLPDGERLAPNG
REREAPAMGSEEGMRAVSTGDCGQVLRGGVIQSTRRRRRASQEANLLTLAQKAVELASLQ
NAKDGSGSEEKRKSVLASTTKCGVEFSEPSLATKRAREDSGMVPLIIPVSVPVRTVDPTE
AAQAGGLDEDGKGPEQNPAEHKPSVIVTRRRSTRIPGTDAQAQAEDMNVKLEGEPSVRKP
KQRPRPEPLIIPTKAGTFIAPPVYSNITPYQSHLRSPVRLADHPSERSFELPPYTPPPIL
SPVREGSGLYFNAIISTSTIPAPPPITPKSAHRTLLRTNSAEVTPPVLSVMGEATPVSIE
PRINVGSRFQAEIPLMRDRALAAADPHKADLVWQPWEDLESSREKQRQVEDLLTAACSSI
FPGAGTNQELALHCLHESRGDILETLNKLLLKKPLRPHNHPLATYHYTGSDQWKMAERKL
FNKGIAIYKKDFFLVQKLIQTKTVAQCVEFYYTYKKQVKIGRNGTLTFGDVDTSDEKSAQ
EEVEVDIKTSQKFPRVPLPRRESPSEERLEPKREVKEPRKEGEEEVPEIQEKEEQEEGRE
RSRRAAAVKATQTLQANESASDILILRSHESNAPGSAGGQASEKPREGTGKSRRALPFSE
KKKKTETFSKTQNQENTFPCKKCGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1C7CYX1	0.213	0.204	0.000	1099	1.000	0.951	A0A1C7CYX1.pdb.gz	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
2	AFDB:Q96PN7	0.213	0.188	6.814E-29	1200	0.280	0.244	Q96PN7.pdb.gz	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
3	AFDB:Q05GC8	0.208	0.180	2.854E-27	1220	0.288	0.247	Q05GC8.pdb.gz	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
4	AFDB:Q0GGX2	0.168	0.132	3.471E-19	1363	0.240	0.184	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
5	AFDB:Q9VED3	0.047	0.043	3.937E-4	1186	0.146	0.129	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
6	AFDB:Q3URK3	0.048	0.030	2.018E-3	2007	0.158	0.082	Q3URK3.pdb.gz	TET1_MOUSE Methylcytosine dioxygenase TET1 OS=Mus musculus OX=10090 GN=Tet1 PE=1 SV=3
7	AFDB:Q8IQT4	0.038	0.026	2.139E-3	2133	0.174	0.085	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
8	PDB:7aoaD	0.119	0.334	2.217E-3	343	0.038	0.117	7aoaD.pdb.gz	The topology of chromatin-binding domains in the NuRD deacetylase complex.
9	AFDB:Q8JGS1	0.037	0.040	2.548E-3	1263	0.123	0.102	Q8JGS1.pdb.gz	STIL_DANRE SCL-interrupting locus protein homolog OS=Danio rerio OX=7955 GN=stil PE=1 SV=2
10	AFDB:F1R3C6	0.041	0.027	4.308E-3	1855	0.160	0.090	F1R3C6.pdb.gz	F1R3C6_DANRE Methylcytosine dioxygenase TET OS=Danio rerio OX=7955 GN=tet1 PE=2 SV=1
11	AFDB:P34278	0.055	0.058	5.441E-3	1010	0.105	0.109	P34278.pdb.gz	KNL1_CAEEL Kinetochore null protein 1 OS=Caenorhabditis elegans OX=6239 GN=knl-1 PE=1 SV=3
12	PDB:4czzB	0.043	0.327	7.352E-2	133	0.024	0.188	4czzB.pdb.gz	Differential Properties of Transcriptional Complexes Formed by the Corest Family.
13	PDB:5l3cB	0.043	0.325	1.173E-1	134	0.023	0.179	5l3cB.pdb.gz	LSD1/KDM1A mutations associated to a newly described form of intellectual disability impair demethylase activity and binding to transcription factors.
14	PDB:6lthO	0.045	0.118	1.173E-1	325	0.026	0.083	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
15	PDB:1oqyA	0.041	0.103	4.234E-1	363	0.040	0.116	1oqyA.pdb.gz
16	PDB:7vdvW	0.043	0.169	5.044E-1	248	0.017	0.073	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
17	PDB:6k15H	0.040	0.099	9.584E-1	393	0.033	0.087	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
18	PDB:7c4jB	0.043	0.109	1.016	395	0.031	0.081	7c4jB.pdb.gz
19	PDB:7td5F	0.039	0.088	1.210	447	0.036	0.085	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
20	PDB:6fec3	0.041	0.076	2.170	419	0.019	0.048	6fec3.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1C7CYX1	0.0	2122	1099	1.000	0.951	A0A1C7CYX1_HUMAN Mitotic deacetylase associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=1
2	Q6PJG2	0.0	2118	1045	1.000	1.000	MDEAS_HUMAN Mitotic deacetylase-associated SANT domain protein OS=Homo sapiens OX=9606 GN=MIDEAS PE=1 SV=2
3	Q96PN7	2.73e-75	273	1200	0.136	0.118	TREF1_HUMAN Transcriptional-regulating factor 1 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
4	Q05GC8	3.32e-75	273	1220	0.136	0.116	Q05GC8_HUMAN Breast cancer anti-estrogen resistance 2 OS=Homo sapiens OX=9606 GN=TRERF1 PE=1 SV=1
5	Q9H0D2	4.37e-75	273	1346	0.138	0.107	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
6	Q0GGX2	2.08e-74	271	1363	0.135	0.103	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
7	Q20733	2.00e-14	80.5	900	0.053	0.061	SAEG1_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=2
8	A8WHS4	2.53e-14	79.7	676	0.053	0.081	A8WHS4_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
9	A8WHS5	3.60e-14	79.0	580	0.053	0.095	A8WHS5_CAEEL Suppressor of activated egl-4 protein 1 OS=Caenorhabditis elegans OX=6239 GN=saeg-1 PE=1 SV=1
10	Q6PGA0	2.23e-07	57.0	451	0.037	0.086	RCOR3_MOUSE REST corepressor 3 OS=Mus musculus OX=10090 GN=Rcor3 PE=1 SV=2
11	Q7Z3K6	2.52e-07	57.0	550	0.048	0.091	MIER3_HUMAN Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2
12	Q9P2K3	6.71e-07	55.5	495	0.037	0.079	RCOR3_HUMAN REST corepressor 3 OS=Homo sapiens OX=9606 GN=RCOR3 PE=1 SV=2
13	Q8N108	2.11e-06	53.9	512	0.047	0.096	MIER1_HUMAN Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2
14	Q8N344	2.90e-06	53.5	545	0.051	0.097	MIER2_HUMAN Mesoderm induction early response protein 2 OS=Homo sapiens OX=9606 GN=MIER2 PE=1 SV=2
15	E7FF48	1.22e-05	52.0	2315	0.019	0.009	E7FF48_DANRE Nuclear receptor corepressor 2 OS=Danio rerio OX=7955 GN=SMRT PE=1 SV=2
16	Q9UKL0	1.81e-05	50.8	485	0.037	0.080	RCOR1_HUMAN REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2
17	Q8CFE3	2.15e-05	50.8	480	0.037	0.081	RCOR1_MOUSE REST corepressor 1 OS=Mus musculus OX=10090 GN=Rcor1 PE=1 SV=3
18	A0A0B4KG70	3.20e-05	50.4	922	0.045	0.051	A0A0B4KG70_DROME Metastasis associated 1-like, isoform D OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
19	B7Z0T5	4.11e-05	50.1	853	0.045	0.055	B7Z0T5_DROME Metastasis associated 1-like, isoform C OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=1
20	Q9VNF6	4.11e-05	50.1	880	0.045	0.053	Q9VNF6_DROME Metastasis associated 1-like, isoform A OS=Drosophila melanogaster OX=7227 GN=MTA1-like PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01448 ELM2	2.6e-07	42.6	ELM2 domain
2	PF00249 Myb_DNA-binding	7.7	18.1	Myb-like DNA-binding domain
3	PF15963 Myb_DNA-bind_7	2.7e+02	12.8	Myb DNA-binding like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000286523

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361705	0.967	Deoxynucleotidyltransferase terminal-interacting protein 1
2	9606.ENSP00000362649	0.951	Histone deacetylase 1
3	9606.ENSP00000430432	0.759	Histone deacetylase 2
4	9606.ENSP00000383042	0.709	Lysine-specific histone demethylase 1A
5	9606.ENSP00000342609	0.585	Alkaline ceramidase 2
6	9606.ENSP00000439689	0.577	Transcriptional-regulating factor 1
7	9606.ENSP00000439856	0.554	Calcium homeostasis endoplasmic reticulum protein
8	9606.ENSP00000346762	0.535	Staphylococcal nuclease domain-containing protein 1
9	9606.ENSP00000317396	0.527	Pecanex-like 4 (Drosophila)
10	9606.ENSP00000352846	0.520	Zinc finger protein 808
11	9606.ENSP00000455426	0.517	Zinc finger protein 423
12	9606.ENSP00000254803	0.512	Something about silencing protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0003712	0.999	transcription coregulator activity
GO:0061629	0.993	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0016922	0.980	nuclear receptor binding
GO:0003713	0.824	transcription coactivator activity
GO:0097159	0.648	organic cyclic compound binding
GO:1901363	0.643	heterocyclic compound binding
GO:0003676	0.608	nucleic acid binding
GO:0001221	0.586	transcription coregulator binding
GO:0030374	0.579	nuclear receptor coactivator activity
GO:0001223	0.534	transcription coactivator binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0031323	0.960	regulation of cellular metabolic process
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.949	regulation of macromolecule metabolic process
GO:0010468	0.909	regulation of gene expression
GO:0050896	0.881	response to stimulus
GO:0009889	0.876	regulation of biosynthetic process
GO:0031326	0.869	regulation of cellular biosynthetic process
GO:0051252	0.848	regulation of RNA metabolic process
GO:0048518	0.831	positive regulation of biological process
GO:0010556	0.753	regulation of macromolecule biosynthetic process
GO:2001141	0.739	regulation of RNA biosynthetic process
GO:0048522	0.725	positive regulation of cellular process
GO:0006355	0.699	regulation of DNA-templated transcription
GO:0048519	0.666	negative regulation of biological process
GO:0048523	0.548	negative regulation of cellular process
GO:0051716	0.511	cellular response to stimulus
GO:0071704	0.490	organic substance metabolic process
GO:0010604	0.485	positive regulation of macromolecule metabolic process
GO:0051173	0.479	positive regulation of nitrogen compound metabolic process
GO:0044238	0.461	primary metabolic process
GO:0031325	0.447	positive regulation of cellular metabolic process
GO:0023052	0.432	signaling
GO:0007154	0.432	cell communication
GO:0007165	0.418	signal transduction
GO:0043170	0.390	macromolecule metabolic process
GO:0045935	0.387	positive regulation of nucleobase-containing compound metabolic process
GO:0006807	0.385	nitrogen compound metabolic process
GO:0009892	0.383	negative regulation of metabolic process
GO:0010557	0.363	positive regulation of macromolecule biosynthetic process
GO:0031328	0.359	positive regulation of cellular biosynthetic process
GO:0006357	0.349	regulation of transcription by RNA polymerase II
GO:0045893	0.340	positive regulation of DNA-templated transcription
GO:0071840	0.326	cellular component organization or biogenesis
GO:0010605	0.322	negative regulation of macromolecule metabolic process
GO:0016043	0.311	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.554	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]