StarFunc result for job id Q6PJI9

User Input

>input (974 residues)
MAARWSSENVVVEFRDSQATAMSVDCLGQHAVLSGRRFLYIVNLDAPFEGHRKISRQSKW
DIGAVQWNPHDSFAHYFAASSNQRVDLYKWKDGSGEVGTTLQGHTRVISDLDWAVFEPDL
LVTSSVDTYIYIWDIKDTRKPTVALSAVAGASQVKWNKKNANCLATSHDGDVRIWDKRKP
STAVEYLAAHLSKIHGLDWHPDSEHILATSSQDNSVKFWDYRQPRKYLNILPCQVPVWKA
RYTPFSNGLVTVMVPQLRRENSLLLWNVFDLNTPVHTFVGHDDVVLEFQWRKQKEGSKDY
QLVTWSRDQTLRMWRVDSQMQRLCANDILDGVDEFIESISLLPEPEKTLHTEDTDHQHTA
SHGEEEALKEDPPRNLLEERKSDQLGLPQTLQQEFSLINVQIRNVNVEMDAADRSCTVSV
HCSNHRVKMLVKFPAQYPNNAAPSFQFINPTTITSTMKAKLLKILKDTALQKVKRGQSCL
EPCLRQLVSCLESFVNQEDSASSNPFALPNSVTPPLPTFARVTTAYGSYQDANIPFPRTS
GARFCGAGYLVYFTRPMTMHRAVSPTEPTPRSLSALSAYHTGLIAPMKIRTEAPGNLRLY
SGSPTRSEKEQVSISSFYYKERKSRRWKSKREGSDSGNRQIKAAGKVIIQDIACLLPVHK
SLGELYILNVNDIQETCQKNAASALLVGRKDLVQVWSLATVATDLCLGPKSDPDLETPWA
RHPFGRQLLESLLAHYCRLRDVQTLAMLCSVFEAQSRPQGLPNPFGPFPNRSSNLVVSHS
RYPSFTSSGSCSSMSDPGLNTGGWNIAGREAEHLSSPWGESSPEELRFGSLTYSDPRERE
RDQHDKNKRLLDPANTQQFDDFKKCYGEILYRWGLREKRAEVLKFVSCPPDPHKGIEFGV
YCSHCRSEVRGTQCAICKGFTFQCAICHVAVRGSSNFCLTCGHGGHTSHMMEWFRTQEVC
PTGCGCHCLLESTF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJI9	1.000	1.000	0.000	974	1.000	1.000	Q6PJI9.pdb.gz	WDR59_HUMAN GATOR2 complex protein WDR59 OS=Homo sapiens OX=9606 GN=WDR59 PE=1 SV=2
2	AFDB:Q9VKK2	0.336	0.337	5.835E-85	969	0.337	0.338	Q9VKK2.pdb.gz	WDR59_DROME GATOR2 complex protein Wdr59 OS=Drosophila melanogaster OX=7227 GN=Wdr59 PE=1 SV=3
3	AFDB:Q03897	0.314	0.270	2.157E-61	1148	0.251	0.213	Q03897.pdb.gz	WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTC5 PE=1 SV=1
4	AFDB:O13686	0.312	0.231	6.583E-60	1323	0.271	0.200	O13686.pdb.gz	WDR59_SCHPO Uncharacterized RWD, RING finger and WD repeat-containing protein C11E3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11E3.05 PE=1 SV=1
5	PDB:7uhyD	0.241	0.708	3.690E-39	288	0.296	1.000	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
6	AFDB:Q8CFJ9	0.285	0.349	2.507E-32	790	0.171	0.211	Q8CFJ9.pdb.gz	WDR24_MOUSE GATOR2 complex protein WDR24 OS=Mus musculus OX=10090 GN=Wdr24 PE=1 SV=1
7	PDB:7uhyC	0.284	0.472	1.203E-30	578	0.147	0.247	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
8	AFDB:A0A499FJD3	0.278	0.294	1.799E-30	920	0.163	0.173	A0A499FJD3.pdb.gz	A0A499FJD3_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
9	AFDB:O14186	0.286	0.328	2.449E-28	846	0.164	0.189	O14186.pdb.gz	YDSB_SCHPO Uncharacterized WD repeat-containing protein C4F8.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F8.11 PE=4 SV=1
10	AFDB:Q86BR7	0.282	0.351	2.449E-28	777	0.138	0.172	Q86BR7.pdb.gz	Q86BR7_DROME GATOR complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=3 SV=2
11	AFDB:Q08281	0.292	0.216	1.329E-24	1341	0.171	0.125	Q08281.pdb.gz	RTC1_YEAST Restriction of telomere capping protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTC1 PE=1 SV=2
12	AFDB:A0A1P8AW69	0.282	0.270	2.743E-20	1019	0.123	0.118	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
13	PDB:7qe7R	0.277	0.589	4.286E-19	440	0.065	0.143	7qe7R.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:3jcmB	0.281	0.617	8.583E-19	429	0.057	0.131	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
15	PDB:7bt6x	0.261	0.489	1.545E-18	488	0.072	0.143	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
16	PDB:7mq8LU	0.279	0.592	1.719E-18	445	0.056	0.124	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:2h9lA	0.275	0.796	2.498E-18	321	0.061	0.184	2h9lA.pdb.gz
18	PDB:5lcwR	0.276	0.670	3.442E-18	383	0.054	0.138	5lcwR.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
19	PDB:3dm0A	0.273	0.387	4.040E-18	675	0.049	0.071	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
20	PDB:7uhyA	0.247	0.308	4.495E-18	771	0.129	0.163	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PJI9	0.0	2038	974	1.000	1.000	WDR59_HUMAN GATOR2 complex protein WDR59 OS=Homo sapiens OX=9606 GN=WDR59 PE=1 SV=2
2	Q9VKK2	1.01e-174	536	969	0.351	0.353	WDR59_DROME GATOR2 complex protein Wdr59 OS=Drosophila melanogaster OX=7227 GN=Wdr59 PE=1 SV=3
3	O13686	1.91e-78	282	1323	0.283	0.209	WDR59_SCHPO Uncharacterized RWD, RING finger and WD repeat-containing protein C11E3.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11E3.05 PE=1 SV=1
4	Q03897	1.10e-57	218	1148	0.150	0.127	WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MTC5 PE=1 SV=1
5	Q9BQ67	4.00e-12	72.0	446	0.036	0.078	GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1
6	Q9XZ25	5.41e-12	72.4	776	0.071	0.089	WDR24_DROME GATOR2 complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=1 SV=1
7	Q86BR7	5.60e-12	72.4	777	0.071	0.089	Q86BR7_DROME GATOR complex protein WDR24 OS=Drosophila melanogaster OX=7227 GN=Wdr24 PE=3 SV=2
8	O00628	7.47e-12	70.1	323	0.054	0.164	PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens OX=9606 GN=PEX7 PE=1 SV=1
9	Q8CFJ9	1.19e-11	71.2	790	0.075	0.092	WDR24_MOUSE GATOR2 complex protein WDR24 OS=Mus musculus OX=10090 GN=Wdr24 PE=1 SV=1
10	Q96S15	2.00e-11	70.5	790	0.074	0.091	WDR24_HUMAN GATOR2 complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=2
11	A0A8I6AQI0	4.69e-11	68.6	489	0.055	0.110	A0A8I6AQI0_RAT RB binding protein 4, chromatin remodeling factor OS=Rattus norvegicus OX=10116 GN=Rbbp4 PE=1 SV=1
12	P43254	4.93e-11	68.9	675	0.054	0.079	COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana OX=3702 GN=COP1 PE=1 SV=2
13	A0A499FJD3	6.56e-11	68.9	920	0.043	0.046	A0A499FJD3_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
14	A0A3B3ISA1	6.76e-11	68.9	864	0.043	0.049	A0A3B3ISA1_HUMAN GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24 PE=1 SV=1
15	O43172	8.41e-11	68.2	522	0.067	0.125	PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens OX=9606 GN=PRPF4 PE=1 SV=2
16	Q9P783	8.79e-11	67.8	480	0.049	0.100	RRB1_SCHPO Ribosome assembly protein rrb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrb1 PE=1 SV=1
17	Q5T1M7	8.92e-11	67.8	521	0.067	0.125	Q5T1M7_HUMAN 60 kDa U4/U6 snRNP-specific spliceosomal protein OS=Homo sapiens OX=9606 GN=PRPF4 PE=2 SV=1
18	Q7ZTX2	1.21e-10	66.2	334	0.071	0.207	Q7ZTX2_DANRE WD repeat domain 5 OS=Danio rerio OX=7955 GN=wu:fk47f04 PE=1 SV=1
19	P61964	1.31e-10	66.2	334	0.071	0.207	WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=WDR5 PE=1 SV=1
20	P61965	1.31e-10	66.2	334	0.071	0.207	WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Wdr5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	68	15.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF20426 NBCH_WD40	3e+02	11.6	Neurobeachin beta propeller domain
3	PF05773 RWD	20	16.9	RWD domain
4	PF00400 WD40	2.7e-09	48.7	WD domain, G-beta repeat
5	PF17120 zf-RING_16	8.8e-08	43.0	RING/Ubox like zinc-binding domain
6	PF17034 zinc_ribbon_16	0.0013	30.3	Zinc-ribbon like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262144

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339881	0.999	GATOR complex protein MIOS
2	9606.ENSP00000382779	0.999	Nucleoporin SEH1
3	9606.ENSP00000232501	0.998	GATOR complex protein NPRL2
4	9606.ENSP00000373312	0.998	Protein SEC13 homolog
5	9606.ENSP00000383105	0.998	GATOR complex protein DEPDC5
6	9606.ENSP00000483814	0.994	GATOR complex protein NPRL3
7	9606.ENSP00000293883	0.992	GATOR complex protein WDR24
8	9606.ENSP00000253063	0.977	Sestrin-2
9	9606.ENSP00000262850	0.977	Ras-related GTP-binding protein B
10	9606.ENSP00000362092	0.974	Ras-related GTP-binding protein C
11	9606.ENSP00000369899	0.974	Ras-related GTP-binding protein A
12	9606.ENSP00000262187	0.973	GTP-binding protein Rheb
13	9606.ENSP00000358423	0.971	Ras-related GTP-binding protein D
14	9606.ENSP00000384183	0.965	Cytosolic arginine sensor for mTORC1 subunit 1
15	9606.ENSP00000307208	0.957	Nucleosome-remodeling factor subunit BPTF
16	9606.ENSP00000343118	0.953	Ragulator complex protein LAMTOR4
17	9606.ENSP00000278671	0.948	Ragulator complex protein LAMTOR1
18	9606.ENSP00000307272	0.948	Regulatory-associated protein of mTOR
19	9606.ENSP00000354558	0.945	Serine/threonine-protein kinase mTOR
20	9606.ENSP00000424183	0.945	Ragulator complex protein LAMTOR3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.311	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.996	regulation of cellular process
GO:0051716	0.978	cellular response to stimulus
GO:1902531	0.966	regulation of intracellular signal transduction
GO:0007154	0.961	cell communication
GO:0048584	0.950	positive regulation of response to stimulus
GO:0033554	0.950	cellular response to stress
GO:1990928	0.943	response to amino acid starvation
GO:0071496	0.930	cellular response to external stimulus
GO:0032006	0.923	regulation of TOR signaling
GO:0048522	0.922	positive regulation of cellular process
GO:0031669	0.905	cellular response to nutrient levels
GO:0009267	0.902	cellular response to starvation
GO:1902533	0.902	positive regulation of intracellular signal transduction
GO:0034198	0.813	cellular response to amino acid starvation
GO:0032008	0.795	positive regulation of TOR signaling
GO:0008152	0.435	metabolic process
GO:0071704	0.332	organic substance metabolic process
GO:0019222	0.322	regulation of metabolic process
GO:0044238	0.303	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0098852	0.995	lytic vacuole membrane
GO:0005765	0.987	lysosomal membrane
GO:0061700	0.979	GATOR2 complex
GO:0005654	0.387	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]