StarFunc result for job id Q6PJP8

User Input

>input (1040 residues)
MLEDISEEDIWEYKSKRKPKRVDPNNGSKNILKSVEKATDGKYQSKRSRNRKRAAEAKEV
KDHEVPLGNAGCQTSVASSQNSSCGDGIQQTQDKETTPGKLCRTQKSQHVSPKIRPVYDG
YCPNCQMPFSSLIGQTPRWHVFECLDSPPRSETECPDGLLCTSTIPFHYKRYTHFLLAQS
RAGDHPFSSPSPASGGSFSETKSGVLCSLEERWSSYQNQTDNSVSNDPLLMTQYFKKSPS
LTEASEKISTHIQTSQQALQFTDFVENDKLVGVALRLANNSEHINLPLPENDFSDCEISY
SPLQSDEDTHDIDEKPDDSQEQLFFTESSKDGSLEEDDDSCGFFKKRHGPLLKDQDESCP
KVNSFLTRDKYDEGLYRFNSLNDLSQPISQNNESTLPYDLACTGGDFVLFPPALAGKLAA
SVHQATKAKPDEPEFHSAQSNKQKQVIEESSVYNQVSLPLVKSLMLKPFESQVEGYLSSQ
PTQNTIRKLSSENLNAKNNTNSACFCRKALEGVPVGKATILNTENLSSTPAPKYLKILPS
GLKYNARHPSTKVMKQMDIGVYFGLPPKRKEEKLLGESALEGINLNPVPSPNQKRSSQCK
RKAEKSLSDLEFDASTLHESQLSVELSSERSQRQKKRCRKSNSLQEGACQKRSDHLINTE
SEAVNLSKVKVFTKSAHGGLQRGNKKIPESSNVGGSRKKTCPFYKKIPGTGFTVDAFQYG
VVEGCTAYFLTHFHSDHYAGLSKHFTFPVYCSEITGNLLKNKLHVQEQYIHPLPLDTECI
VNGVKVVLLDANHCPGAVMILFYLPNGTVILHTGDFRADPSMERSLLADQKVHMLYLDTT
YCSPEYTFPSQQEVIRFAINTAFEAVTLNPHALVVCGTYSIGKEKVFLAIADVLGSKVGM
SQEKYKTLQCLNIPEINSLITTDMCSSLVHLLPMMQINFKGLQSHLKKCGGKYNQILAFR
PTGWTHSNKFTRIADVIPQTKGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGT
WKSRSTMEKYFREWKLEAGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJP8	1.000	1.000	0.000	1040	1.000	1.000	Q6PJP8.pdb.gz	DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens OX=9606 GN=DCLRE1A PE=1 SV=3
2	AFDB:Q5QJC4	0.372	0.396	3.579E-80	972	0.436	0.466	Q5QJC4.pdb.gz	DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus OX=9031 GN=DCLRE1A PE=1 SV=1
3	PDB:7sglD	0.276	0.670	3.665E-22	406	0.094	0.241	7sglD.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
4	PDB:6v4xH	0.241	0.476	1.471E-13	499	0.059	0.122	6v4xH.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
5	PDB:3t3oA	0.233	0.414	8.703E-12	553	0.064	0.121	3t3oA.pdb.gz	Molecular Basis for the Recognition and Cleavage of RNA by the Bifunctional 5'-3' Exo/Endoribonuclease RNase J.
6	PDB:2ycbB	0.221	0.345	1.482E-11	635	0.057	0.093	2ycbB.pdb.gz	Structure and Activity of a Novel Archaeal Beta-Casp Protein with N-Terminal Kh Domains.
7	PDB:3zq4A	0.233	0.421	1.769E-11	550	0.063	0.120	3zq4A.pdb.gz	Unusual, Dual Endo- and Exonuclease Activity in the Degradosome Explained by Crystal Structure Analysis of Rnase J1.
8	PDB:7sn8K	0.214	0.357	1.769E-11	588	0.055	0.097	7sn8K.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
9	PDB:7pksk	0.220	0.470	3.404E-10	458	0.044	0.100	7pksk.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
10	PDB:7bfqB	0.216	0.358	4.853E-10	590	0.049	0.086	7bfqB.pdb.gz
11	PDB:6v4xI	0.226	0.429	1.051E-8	510	0.047	0.096	6v4xI.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
12	PDB:7sn8I	0.197	0.305	1.055E-7	634	0.039	0.065	7sn8I.pdb.gz	Inositol hexakisphosphate is required for Integrator function.
13	AFDB:Q9NSY1	0.037	0.034	2.986E-1	1161	0.092	0.083	Q9NSY1.pdb.gz	BMP2K_HUMAN BMP-2-inducible protein kinase OS=Homo sapiens OX=9606 GN=BMP2K PE=1 SV=2
14	AFDB:A4D0Q3	0.037	0.046	3.361E-1	759	0.106	0.145	A4D0Q3.pdb.gz	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
15	AFDB:B0R0I6	0.081	0.044	5.085E-1	2511	0.123	0.051	B0R0I6.pdb.gz	CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio OX=7955 GN=chd8 PE=3 SV=2
16	AFDB:Q9Y7K6	0.044	0.055	5.394E-1	741	0.087	0.123	Q9Y7K6.pdb.gz	YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.04c PE=4 SV=1
17	AFDB:Q6DFV3	0.027	0.019	9.185E-1	1944	0.114	0.061	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
18	AFDB:Q6FTP4	0.044	0.058	1.474	722	0.085	0.122	Q6FTP4.pdb.gz	Q6FTP4_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G00902g PE=4 SV=1
19	AFDB:O16117	0.040	0.047	1.659	844	0.107	0.132	O16117.pdb.gz	O16117_DROME Shaven, isoform A OS=Drosophila melanogaster OX=7227 GN=sv PE=2 SV=1
20	AFDB:Q63767	0.039	0.041	1.659	968	0.092	0.099	Q63767.pdb.gz	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5QJC4	0.0	625	972	0.305	0.326	DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus OX=9031 GN=DCLRE1A PE=1 SV=1
2	Q6PJP8	0.0	2167	1040	1.000	1.000	DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens OX=9606 GN=DCLRE1A PE=1 SV=3
3	Q9JIC3	0.0	1196	1026	0.635	0.643	DCR1A_MOUSE DNA cross-link repair 1A protein OS=Mus musculus OX=10090 GN=Dclre1a PE=1 SV=2
4	Q38961	3.14e-111	355	484	0.183	0.393	SNM1_ARATH DNA cross-link repair protein SNM1 OS=Arabidopsis thaliana OX=3702 GN=SNM1 PE=2 SV=1
5	Q10264	4.41e-70	246	560	0.133	0.246	PSO2_SCHPO DNA cross-link repair protein pso2/snm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pso2 PE=3 SV=3
6	Q86KS1	2.97e-65	240	920	0.128	0.145	DCR1_DICDI DNA cross-link repair 1 protein OS=Dictyostelium discoideum OX=44689 GN=dclre1 PE=3 SV=1
7	F4HPZ9	1.84e-52	203	1396	0.117	0.087	LIG6_ARATH DNA ligase 6 OS=Arabidopsis thaliana OX=3702 GN=LIG6 PE=2 SV=1
8	P30620	2.75e-45	176	661	0.132	0.207	PSO2_YEAST DNA cross-link repair protein PSO2/SNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PSO2 PE=1 SV=1
9	Q9H816	1.20e-42	166	532	0.110	0.214	DCR1B_HUMAN 5' exonuclease Apollo OS=Homo sapiens OX=9606 GN=DCLRE1B PE=1 SV=1
10	Q8C7W7	9.47e-42	164	541	0.105	0.201	DCR1B_MOUSE 5' exonuclease Apollo OS=Mus musculus OX=10090 GN=Dclre1b PE=1 SV=2
11	Q8T3E0	2.47e-22	105	608	0.090	0.155	Q8T3E0_CAEEL MoRTal germline OS=Caenorhabditis elegans OX=6239 GN=mrt-1 PE=1 SV=1
12	Q8K4J0	1.57e-21	103	705	0.096	0.142	DCR1C_MOUSE Protein artemis OS=Mus musculus OX=10090 GN=Dclre1c PE=1 SV=2
13	Q581T3	5.65e-21	101	720	0.068	0.099	Q581T3_TRYB2 DNA repair metallo-beta-lactamase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.710 PE=4 SV=1
14	Q96SD1	1.54e-20	99.8	692	0.103	0.155	DCR1C_HUMAN Protein artemis OS=Homo sapiens OX=9606 GN=DCLRE1C PE=1 SV=2
15	A0A3B3ITQ0	8.21e-18	90.1	471	0.051	0.113	A0A3B3ITQ0_HUMAN DNA cross-link repair 1B OS=Homo sapiens OX=9606 GN=DCLRE1B PE=1 SV=1
16	Q72JJ7	0.004	43.5	573	0.041	0.075	RNJ_THET2 Ribonuclease J OS=Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) OX=262724 GN=rnj PE=1 SV=1
17	Q45493	0.014	41.6	555	0.028	0.052	RNJ1_BACSU Ribonuclease J1 OS=Bacillus subtilis (strain 168) OX=224308 GN=rnjA PE=1 SV=1
18	C4LYY1	0.031	40.8	881	0.030	0.035	C4LYY1_ENTH1 DNA replication licensing factor MCM2 OS=Entamoeba histolytica (strain ATCC 30459 / HM-1:IMSS / ABRM) OX=294381 GN=EHI_117970 PE=3 SV=1
19	Q6GHZ6	0.098	38.9	565	0.036	0.065	RNJ1_STAAR Ribonuclease J 1 OS=Staphylococcus aureus (strain MRSA252) OX=282458 GN=rnj1 PE=1 SV=1
20	Q9Z7K1	0.48	36.6	371	0.015	0.043	Q9Z7K1_CHLPN Flagellar motor switch Domain/YscQ family OS=Chlamydia pneumoniae OX=83558 GN=fliN PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07522 DRMBL	2.1e-32	123.1	DNA repair metallo-beta-lactamase
2	PF02015 Glyco_hydro_45	1.3e+02	13.9	Glycosyl hydrolase family 45
3	PF00753 Lactamase_B	4.8	18.7	Metallo-beta-lactamase superfamily
4	PF12706 Lactamase_B_2	0.051	24.6	Beta-lactamase superfamily domain
5	PF07521 RMMBL	4.4e+02	12.3	Zn-dependent metallo-hydrolase RNA specificity domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355185

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307491	0.949	WD repeat-containing protein 48
2	9606.ENSP00000343526	0.949	Ubiquitin carboxyl-terminal hydrolase 1
3	9606.ENSP00000358576	0.928	5' exonuclease Apollo
4	9606.ENSP00000307853	0.919	Crossover junction endonuclease MUS81
5	9606.ENSP00000267430	0.904	Fanconi anemia group M protein
6	9606.ENSP00000294008	0.895	Structure-specific endonuclease subunit SLX4
7	9606.ENSP00000287647	0.885	Fanconi anemia group D2 protein
8	9606.ENSP00000013807	0.882	DNA excision repair protein ERCC-1
9	9606.ENSP00000354497	0.880	Fanconi-associated nuclease 1
10	9606.ENSP00000310520	0.872	DNA repair endonuclease XPF
11	9606.ENSP00000310842	0.864	Fanconi anemia group I protein
12	9606.ENSP00000466121	0.846	Fanconi anemia core complex-associated protein 24
13	9606.ENSP00000351697	0.845	DNA polymerase zeta catalytic subunit
14	9606.ENSP00000238112	0.804	Cleavage and polyadenylation specificity factor subunit 3
15	9606.ENSP00000355506	0.803	Exonuclease 1
16	9606.ENSP00000435506	0.801	DNA polymerase nu
17	9606.ENSP00000298875	0.790	Cleavage and polyadenylation specificity factor subunit 2
18	9606.ENSP00000376952	0.790	Crossover junction endonuclease EME1
19	9606.ENSP00000385021	0.785	E3 ubiquitin-protein ligase FANCL
20	9606.ENSP00000356243	0.783	Ubiquitin-conjugating enzyme E2 T

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008800	1.000	beta-lactamase activity
GO:0035312	1.000	5'-3' DNA exonuclease activity
GO:0005488	0.872	binding
GO:0005515	0.821	protein binding
GO:0097159	0.344	organic cyclic compound binding
GO:1901363	0.341	heterocyclic compound binding
GO:0004519	0.330	endonuclease activity
GO:0003676	0.317	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006281	0.997	DNA repair
GO:0006289	0.532	nucleotide-excision repair
GO:0050789	0.431	regulation of biological process
GO:0050794	0.423	regulation of cellular process
GO:0006302	0.313	double-strand break repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	0.995	nucleolus
GO:0001650	0.980	fibrillar center
GO:0032991	0.419	protein-containing complex
GO:0005737	0.362	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20401	1.000	a beta-lactam + H2O = a substituted beta-amino acid
EC:3.5.2.6	1.000	beta-lactamase.
EC:3.1.11.-	1.000	Exodeoxyribonucleases producing 5'-phosphomonoesters.

[back to server]