StarFunc result for job id Q6PJT7

User Input

>input (736 residues)
MEIGTEISRKIRSAIKGKLQELGAYVDEELPDYIMVMVANKKSQDQMTEDLSLFLGNNTI
RFTVWLHGVLDKLRSVTTEPSSLKSSDTNIFDSNVPSNKSNFSRGDERRHEAAVPPLAIP
SARPEKRDSRVSTSSQESKTTNVRQTYDDGAATRLMSTVKPLREPAPSEDVIDIKPEPDD
LIDEDLNFVQENPLSQKKPTVTLTYGSSRPSIEIYRPPASRNADSGVHLNRLQFQQQQNS
IHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKLPVVS
SVVKVKKFNHDGEEEEEDDDYGSRTGSISSSVSVPAKPERRPSLPPSKQANKNLILKAIS
EAQESVTKTTNYSTVPQKQTLPVAPRTRTSQEELLAEVVQGQSRTPRISPPIKEEETKGD
SVEKNQGTQQRQLLSRLQIDPVMAETLQMSQDYYDMESMVHADTRSFILKKPKLSEEVVV
APNQESGMKTADSLRVLSGHLMQTRDLVQPDKPASPKFIVTLDGVPSPPGYMSDQEEDMC
FEGMKPVNQTAASNKGLRGLLHPQQLHLLSRQLEDPNGSFSNAEMSELSVAQKPEKLLER
CKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRR
IPVLSPKPAVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTIN
VPPRHALKWIRPQTSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJT7	0.999	0.999	4.349E-104	736	1.000	1.000	Q6PJT7.pdb.gz	ZC3HE_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
2	AFDB:Q7TMD5	0.180	0.180	2.077E-91	736	0.895	0.895	Q7TMD5.pdb.gz	ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus OX=10116 GN=Zc3h14 PE=1 SV=1
3	AFDB:G3V256	0.171	0.199	1.735E-78	605	0.822	1.000	G3V256.pdb.gz	G3V256_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
4	AFDB:Q8CHP0	0.056	0.045	3.541E-3	950	0.167	0.129	Q8CHP0.pdb.gz	ZC3H3_MOUSE Zinc finger CCCH domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zc3h3 PE=1 SV=1
5	AFDB:F1LW07	0.060	0.054	5.863E-2	825	0.135	0.120	F1LW07.pdb.gz	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2
6	AFDB:Q8IXZ2	0.059	0.049	6.241E-2	948	0.171	0.133	Q8IXZ2.pdb.gz	ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZC3H3 PE=1 SV=3
7	AFDB:Q9FWQ5	0.066	0.036	1.591E-1	1706	0.101	0.043	Q9FWQ5.pdb.gz	HAC12_ARATH Histone acetyltransferase HAC12 OS=Arabidopsis thaliana OX=3702 GN=HAC12 PE=3 SV=2
8	AFDB:A0A140VK05	0.062	0.052	5.538E-1	903	0.130	0.106	A0A140VK05.pdb.gz	A0A140VK05_HUMAN Testicular secretory protein Li 5 OS=Homo sapiens OX=9606 PE=2 SV=1
9	AFDB:Q9LE42	0.058	0.031	7.565E-1	1670	0.105	0.046	Q9LE42.pdb.gz	HAC5_ARATH Histone acetyltransferase HAC5 OS=Arabidopsis thaliana OX=3702 GN=HAC5 PE=2 SV=1
10	AFDB:Q54EH1	0.057	0.060	8.571E-1	686	0.101	0.108	Q54EH1.pdb.gz	EPN_DICDI Epsin OS=Dictyostelium discoideum OX=44689 GN=epnA PE=3 SV=1
11	PDB:3vh5A	0.060	0.340	2.539	100	0.014	0.100	3vh5A.pdb.gz
12	PDB:6gejY	0.065	0.096	2.539	447	0.018	0.029	6gejY.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
13	PDB:6t9iF	0.045	0.265	2.539	111	0.015	0.099	6t9iF.pdb.gz
14	PDB:6p6cA	0.050	0.290	3.259	90	0.014	0.111	6p6cA.pdb.gz
15	PDB:7edxc	0.054	0.264	3.259	127	0.027	0.157	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
16	PDB:7aqrV	0.056	0.215	4.182	140	0.016	0.086	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
17	PDB:3ontA	0.050	0.214	4.451	112	0.019	0.125	3ontA.pdb.gz
18	PDB:6z3wD	0.058	0.278	4.451	84	0.012	0.107	6z3wD.pdb.gz
19	PDB:1ci4A	0.061	0.375	5.367	89	0.018	0.146	1ci4A.pdb.gz
20	PDB:6nr7A	0.063	0.045	5.367	1086	0.026	0.017	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V256	0.0	902	605	0.613	0.745	G3V256_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
2	G3V5I6	0.0	541	420	0.368	0.645	G3V5I6_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
3	H0YJA2	0.0	1345	651	0.883	0.998	H0YJA2_HUMAN Zinc finger CCCH domain-containing protein 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
4	Q6PJT7	0.0	1527	736	1.000	1.000	ZC3HE_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
5	Q7TMD5	0.0	1313	736	0.897	0.897	ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus OX=10116 GN=Zc3h14 PE=1 SV=1
6	Q8BJ05	0.0	1329	735	0.898	0.899	ZC3HE_MOUSE Zinc finger CCCH domain-containing protein 14 OS=Mus musculus OX=10090 GN=Zc3h14 PE=1 SV=1
7	A0A087WTC9	2.18e-57	194	148	0.136	0.676	A0A087WTC9_HUMAN Zinc finger CCCH-type containing 14 (Fragment) OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
8	Q9V3H9	5.34e-34	142	1004	0.087	0.064	Q9V3H9_DROME Zinc finger CCCH domain-containing protein 14 OS=Drosophila melanogaster OX=7227 GN=Nab2 PE=1 SV=1
9	Q95XU6	4.31e-20	97.8	740	0.053	0.053	ZC3HE_CAEEL Zinc finger CCCH domain-containing protein 14 OS=Caenorhabditis elegans OX=6239 GN=sut-2 PE=3 SV=2
10	P32505	4.48e-09	62.0	525	0.068	0.095	NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAB2 PE=1 SV=1
11	O19137	0.001	43.5	243	0.045	0.136	CPSF4_BOVIN Cleavage and polyadenylation specificity factor subunit 4 OS=Bos taurus OX=9913 GN=CPSF4 PE=1 SV=1
12	O13713	0.002	43.5	307	0.030	0.072	NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nab2 PE=3 SV=1
13	Q9UTD1	0.031	38.5	170	0.043	0.188	YTH1_SCHPO mRNA 3'-end-processing protein yth1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=yth1 PE=3 SV=1
14	Q382Q6	0.037	39.3	277	0.030	0.079	Q382Q6_TRYB2 Cleavage and polyadenylation specificity factor 30 kDa subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4600 PE=4 SV=1
15	Q86G58	0.037	39.3	277	0.030	0.079	Q86G58_TRYBR Cleavage and polyadenylation specificity factor 30 kDa subunit OS=Trypanosoma brucei rhodesiense OX=31286 PE=4 SV=1
16	O74823	0.060	38.9	376	0.050	0.098	YBJC_SCHPO Zinc finger CCCH domain-containing protein C337.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.12 PE=4 SV=3
17	P22293	0.093	38.9	1325	0.023	0.013	SUS_DROME Protein suppressor of sable OS=Drosophila melanogaster OX=7227 GN=su(sable) PE=1 SV=2
18	O95639	0.23	36.6	269	0.045	0.123	CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 OS=Homo sapiens OX=9606 GN=CPSF4 PE=1 SV=1
19	Q8IXZ2	0.26	37.4	948	0.061	0.047	ZC3H3_HUMAN Zinc finger CCCH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZC3H3 PE=1 SV=3
20	Q9LXV4	0.29	37.0	706	0.029	0.030	C3H56_ARATH Zinc finger CCCH domain-containing protein 56 OS=Arabidopsis thaliana OX=3702 GN=At5g12850 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01480 PWI	1.1e+02	14.5	PWI domain
2	PF14608 zf-CCCH_2	4.7e-14	63.5	RNA-binding, Nab2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251038

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380785	0.934	Protein Hook homolog 2
2	9606.ENSP00000421592	0.902	THO complex subunit 4
3	9606.ENSP00000307863	0.873	Splicing factor U2AF 65 kDa subunit
4	9606.ENSP00000336712	0.848	Transportin-1
5	9606.ENSP00000407182	0.843	Transportin-2
6	9606.ENSP00000397927	0.836	Polymerase delta-interacting protein 3
7	9606.ENSP00000356448	0.825	Nucleoprotein TPR
8	9606.ENSP00000366135	0.821	Exosome component 10
9	9606.ENSP00000436679	0.806	Nuclear RNA export factor 1
10	9606.ENSP00000308622	0.790	Nucleoporin GLE1
11	9606.ENSP00000216727	0.784	Polyadenylate-binding protein 2
12	9606.ENSP00000261600	0.777	THO complex subunit 1
13	9606.ENSP00000298281	0.767	Pre-mRNA cleavage complex 2 protein Pcf11
14	9606.ENSP00000245838	0.722	THO complex subunit 2
15	9606.ENSP00000301215	0.722	Zinc finger protein 526
16	9606.ENSP00000362260	0.716	Zinc finger protein 711
17	9606.ENSP00000379475	0.690	Spliceosome RNA helicase DDX39B
18	9606.ENSP00000326806	0.684	Nuclear cap-binding protein subunit 2
19	9606.ENSP00000476955	0.676	Nuclear cap binding protein subunit 2 like
20	9606.ENSP00000426978	0.665	Nuclear RNA export factor 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0080090	0.996	regulation of primary metabolic process
GO:0051171	0.996	regulation of nitrogen compound metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0009987	0.985	cellular process
GO:0010468	0.981	regulation of gene expression
GO:0051252	0.978	regulation of RNA metabolic process
GO:0048519	0.976	negative regulation of biological process
GO:0048523	0.962	negative regulation of cellular process
GO:0009892	0.961	negative regulation of metabolic process
GO:0010605	0.952	negative regulation of macromolecule metabolic process
GO:0051172	0.933	negative regulation of nitrogen compound metabolic process
GO:0031324	0.886	negative regulation of cellular metabolic process
GO:0045934	0.848	negative regulation of nucleobase-containing compound metabolic process
GO:0008152	0.843	metabolic process
GO:0071704	0.826	organic substance metabolic process
GO:0051253	0.749	negative regulation of RNA metabolic process
GO:0043170	0.744	macromolecule metabolic process
GO:0010556	0.678	regulation of macromolecule biosynthetic process
GO:0031326	0.666	regulation of cellular biosynthetic process
GO:2001141	0.608	regulation of RNA biosynthetic process
GO:0006807	0.559	nitrogen compound metabolic process
GO:0044237	0.558	cellular metabolic process
GO:0044238	0.554	primary metabolic process
GO:0034641	0.478	cellular nitrogen compound metabolic process
GO:1901360	0.448	organic cyclic compound metabolic process
GO:0090304	0.442	nucleic acid metabolic process
GO:0048518	0.439	positive regulation of biological process
GO:0016070	0.410	RNA metabolic process
GO:0010467	0.405	gene expression
GO:0051179	0.381	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0032991	0.910	protein-containing complex
GO:0005737	0.784	cytoplasm
GO:0005730	0.742	nucleolus
GO:0042995	0.375	cell projection
GO:0005829	0.375	cytosol
GO:0120025	0.374	plasma membrane bounded cell projection
GO:0032839	0.358	dendrite cytoplasm
GO:1904115	0.349	axon cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]