StarFunc result for job id Q6PJW8

User Input

>input (725 residues)
MDDSDTPTYYLQIEPQDGCHPGDSVERSVTCLPSASDENENQLDGDGHEHLTSSDSAMGK
PQVSEQDSLNNNESCTLSCEVAAGENLQNTLCEASRDEQAFLGKDKKIPGKRSPRSKKGT
AKKIPPGLFSGDIAPLMQEKVLSAVTYAVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGE
VEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKT
VQPHTVTALRNSEKGFNGEDFERLTKICATHQDPLLSKHKIAAVEKSQERKCSTQLLVSE
DPKEGGATTKESESKTCLGTESSKESQHTVEPLGSSPCCHQMDVQTDSPSLSVTAGKDHM
EELLCSAEATLALHTQSSETAGSPSGPDSSEDACEDDSRLQLAQTEACQDVARIEGIAED
PKVFLSSKSKTEPLISPGCDRIPPALISEGKYSQAQRKELRLPLRDASEALPTDQLENNE
LNELQQPDLTDSDGKSPQAQADSDGSENVLCGNNQISDLGILLPEVCMAPEEKGDKDDQL
NKETEDYLNSLLEGCLKDTEDSLSYEDNQDDDSDLLQDLSPEEASYSLQENLPSDESCLS
LDDLAKRIEIAEVVPTEGLVSILKKRNDTVGDHPAQMQHKPSKRRVRFQEIDDSLDQDEV
GGGSCILLVLLCIATVFLSVGGTALYCTFGDMESPVCTDFADNMDFYYTKLLQGVAELKH
WIYLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PJW8	1.000	1.000	1.169E-101	725	1.000	1.000	Q6PJW8.pdb.gz	CNST_HUMAN Consortin OS=Homo sapiens OX=9606 GN=CNST PE=1 SV=3
2	AFDB:Q8CBC4	0.302	0.307	1.012E-61	711	0.681	0.695	Q8CBC4.pdb.gz	CNST_MOUSE Consortin OS=Mus musculus OX=10090 GN=Cnst PE=1 SV=1
3	AFDB:Q03213	0.076	0.076	3.850E-5	719	0.120	0.121	Q03213.pdb.gz	HOT1_YEAST High-osmolarity-induced transcription protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOT1 PE=1 SV=1
4	AFDB:Q59DP0	0.062	0.065	2.027E-4	680	0.121	0.129	Q59DP0.pdb.gz	Q59DP0_DROME Shaven, isoform D OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=1
5	AFDB:Q8I239	0.054	0.029	3.525E-4	1710	0.143	0.061	Q8I239.pdb.gz	PI51N_PLAF7 Phosphatidylinositol 4-phosphate 5-kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PIP5K PE=1 SV=1
6	AFDB:P25992	0.084	0.064	5.423E-4	1002	0.139	0.101	P25992.pdb.gz	YEMA_DROME yemanuclein OS=Drosophila melanogaster OX=7227 GN=yem PE=1 SV=1
7	AFDB:Q8IM96	0.075	0.082	5.423E-4	647	0.117	0.131	Q8IM96.pdb.gz	Q8IM96_DROME Shaven, isoform C OS=Drosophila melanogaster OX=7227 GN=sv PE=4 SV=3
8	AFDB:Q92615	0.058	0.057	5.423E-4	738	0.137	0.134	Q92615.pdb.gz	LAR4B_HUMAN La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3
9	AFDB:P51023	0.057	0.058	1.364E-3	718	0.120	0.121	P51023.pdb.gz	PNT_DROME ETS-like protein pointed OS=Drosophila melanogaster OX=7227 GN=pnt PE=1 SV=2
10	AFDB:Q6RJR6	0.060	0.050	1.745E-3	940	0.167	0.129	Q6RJR6.pdb.gz	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
11	PDB:7pubFh	0.068	0.162	1.235E-1	274	0.036	0.095	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
12	PDB:7msnA	0.068	0.113	1.397E-1	417	0.026	0.046	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
13	PDB:7qe7Y	0.079	0.113	1.680E-1	502	0.014	0.020	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
14	PDB:5jheA	0.071	0.129	3.974E-1	388	0.014	0.026	5jheA.pdb.gz
15	PDB:6a73A	0.069	0.160	4.226E-1	290	0.029	0.072	6a73A.pdb.gz	Basis for metabolite-dependent Cullin-RING ligase deneddylation by the COP9 signalosome.
16	PDB:1ihgA	0.068	0.128	4.779E-1	364	0.011	0.022	1ihgA.pdb.gz
17	PDB:6yj6A	0.068	0.060	6.112E-1	819	0.021	0.018	6yj6A.pdb.gz
18	PDB:2y4uA	0.068	0.114	7.817E-1	424	0.030	0.052	2y4uA.pdb.gz
19	PDB:1pc2A	0.065	0.288	8.313E-1	152	0.022	0.105	1pc2A.pdb.gz
20	PDB:5n9jZ	0.069	0.340	8.841E-1	119	0.025	0.151	5n9jZ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PJW8	0.0	1481	725	1.000	1.000	CNST_HUMAN Consortin OS=Homo sapiens OX=9606 GN=CNST PE=1 SV=3
2	Q8CBC4	0.0	914	711	0.683	0.696	CNST_MOUSE Consortin OS=Mus musculus OX=10090 GN=Cnst PE=1 SV=1
3	Q9NVR2	0.54	36.2	710	0.047	0.048	INT10_HUMAN Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2
4	A0A0G2JUN9	1.6	34.7	1078	0.036	0.024	A0A0G2JUN9_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
5	F1LRA7	1.6	34.7	1100	0.036	0.024	F1LRA7_RAT Mitogen-activated protein kinase kinase kinase OS=Rattus norvegicus OX=10116 GN=Map3k9 PE=3 SV=2
6	Q18825	2.3	33.9	811	0.023	0.021	BAR1_CAEEL Beta-catenin/armadillo-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=bar-1 PE=1 SV=2
7	P80192	4.0	33.5	1104	0.034	0.023	M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens OX=9606 GN=MAP3K9 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15281 Consortin_C	6.4e-51	182.4	Consortin C-terminus
2	PF13181 TPR_8	5.9e+02	12.1	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348521	0.808	Gap junction beta-6 protein
2	9606.ENSP00000411528	0.808	Gap junction gamma-1 protein
3	9606.ENSP00000372295	0.773	Gap junction beta-2 protein
4	9606.ENSP00000341779	0.765	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
5	9606.ENSP00000311962	0.762	ADP-ribosylation factor-binding protein GGA2
6	9606.ENSP00000326031	0.760	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
7	9606.ENSP00000363134	0.733	Gap junction beta-1 protein
8	9606.ENSP00000253193	0.725	Low-density lipoprotein receptor-related protein 3
9	9606.ENSP00000282561	0.684	Gap junction alpha-1 protein
10	9606.ENSP00000341344	0.666	ADP-ribosylation factor-binding protein GGA1
11	9606.ENSP00000403644	0.553	Aromatic-L-amino-acid decarboxylase
12	9606.ENSP00000352601	0.500	Low-density lipoprotein receptor-related protein 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019902	1.000	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.972	regulation of biological process
GO:0050794	0.919	regulation of cellular process
GO:0048522	0.911	positive regulation of cellular process
GO:0032880	0.831	regulation of protein localization
GO:1903829	0.823	positive regulation of protein localization
GO:1903076	0.805	regulation of protein localization to plasma membrane
GO:1904951	0.695	positive regulation of establishment of protein localization
GO:1905477	0.643	positive regulation of protein localization to membrane
GO:1904377	0.643	positive regulation of protein localization to cell periphery
GO:1903078	0.629	positive regulation of protein localization to plasma membrane
GO:0060627	0.616	regulation of vesicle-mediated transport
GO:0051223	0.588	regulation of protein transport
GO:0009987	0.580	cellular process
GO:0051050	0.579	positive regulation of transport
GO:0051222	0.471	positive regulation of protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005886	0.999	plasma membrane
GO:0031984	0.998	organelle subcompartment
GO:0031410	0.996	cytoplasmic vesicle
GO:0005794	0.995	Golgi apparatus
GO:0005802	0.994	trans-Golgi network
GO:0030133	0.981	transport vesicle
GO:0031090	0.418	organelle membrane
GO:0005768	0.354	endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]