StarFunc result for job id Q6PKC3

User Input

>input (985 residues)
MSECGGRGGGSSSSEDAEDEGGGGGGPAGSDCLSSSPTLATASSAGRLRRGLRGAFLMAR
QRPELLCGAVALGCALLLALKFTCSRAKDVIIPAKPPVSFFSLRSPVLDLFQGQLDYAEY
VRRDSEVVLLFFYAPWCGQSIAARAEIEQAASRLSDQVLFVAINCWWNQGKCRKQKHFFY
FPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGYF
EFSGSPQPPGYLTFFTSALHSLKKALESTSSPRALVSFTGEWHLETKIYVLDYLGTVRFG
VITNKHLAKLVSLVHSGSVYLHRHFNTSLVFPREVLNYTAENICKWALENQETLFRWLRP
HGGKSLLLNNELKKGPALFLFIPFNPLAESHPLIDEITEVALEYNNCHGDQVVERLLQHL
RRVDAPVLESLALEVPAQLPDPPTITASPCCNTVVLPQWHSFSRTHNVCELCVNQTSGGM
KPSSVSVPQCSFFEMAAALDSFYLKEQTFYHVASDSIECSNFLTSYSPFSYYTACCRTIS
RGVSGFIDSEQGVFEAPTVAFSSLEKKCEVDAPSSVPHIEENRYLFPEVDMTSTNFTGLS
CRTNKTLNIYLLDSNLFWLYAERLGAPSSTQVKEFAAIVDVKEESHYILDPKQALMKLTL
ESFIQNFSVLYSPLKRHLIGSGSAQFPSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCG
FCPSLNHIFIQLARNLPMDTFTVARIDVSQNDLPWEFMVDRLPTVLFFPCNRKDLSVKYP
EDVPITLPNLLRFILHHSDPASSPQNVANSPTKECLQSEAVLQRGHISHLEREIQKLRAE
ISSLQRAQVQVESQLSSARRDEHRLRQQQRALEEQHSLLHAHSEQLQALYEQKTRELQEL
ARKLQELADASENLLTENTWLKILVATMERKLEGRDGAESLAAQREVHPKQPEPSATPQL
PGSSPPPANVSATLVSERNKENRTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PKC3	1.000	1.000	0.000	985	1.000	1.000	Q6PKC3.pdb.gz	TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens OX=9606 GN=TXNDC11 PE=1 SV=2
2	AFDB:Q4WH99	0.322	0.540	1.194E-26	517	0.113	0.215	Q4WH99.pdb.gz	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
3	AFDB:A2QFJ8	0.331	0.566	2.478E-26	515	0.112	0.214	A2QFJ8.pdb.gz	A2QFJ8_ASPNC Protein disulfide-isomerase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pdiA PE=3 SV=1
4	AFDB:Q10057	0.209	0.395	3.672E-26	492	0.109	0.217	Q10057.pdb.gz	PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.02 PE=3 SV=1
5	AFDB:P38659	0.191	0.286	7.623E-26	643	0.123	0.188	P38659.pdb.gz	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2
6	AFDB:P13667	0.186	0.280	1.414E-25	645	0.121	0.184	P13667.pdb.gz	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
7	AFDB:Q9FF55	0.228	0.361	1.582E-25	597	0.106	0.174	Q9FF55.pdb.gz	PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-4 PE=1 SV=1
8	AFDB:P34329	0.193	0.290	2.345E-25	618	0.118	0.188	P34329.pdb.gz	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
9	AFDB:Q66GQ3	0.284	0.442	4.112E-25	534	0.116	0.213	Q66GQ3.pdb.gz	PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-6 PE=2 SV=1
10	AFDB:Q8VX13	0.243	0.390	9.552E-25	579	0.116	0.197	Q8VX13.pdb.gz	PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-3 PE=2 SV=1
11	PDB:3f8uA	0.286	0.505	1.018E-24	469	0.114	0.239	3f8uA.pdb.gz
12	PDB:4ekzA	0.235	0.390	1.510E-23	469	0.102	0.213	4ekzA.pdb.gz
13	PDB:3apoA	0.105	0.137	2.384E-14	688	0.090	0.129	3apoA.pdb.gz
14	PDB:5crgA	0.209	0.517	2.826E-12	354	0.058	0.161	5crgA.pdb.gz	Characterization of Two Human Skeletal Calsequestrin Mutants Implicated in Malignant Hyperthermia and Vacuolar Aggregate Myopathy.
15	PDB:7f05C	0.209	0.520	2.136E-11	355	0.053	0.146	7f05C.pdb.gz	Ca2+-dependent Formation of a Non-transmembrane Channel in a Calsequestrin-2 Dimer
16	PDB:5gu6A	0.180	0.399	2.674E-11	377	0.052	0.135	5gu6A.pdb.gz
17	PDB:2r2jA	0.164	0.425	9.217E-9	328	0.053	0.159	2r2jA.pdb.gz
18	PDB:3ed3A	0.115	0.387	2.397E-7	267	0.048	0.176	3ed3A.pdb.gz
19	PDB:4f9zA	0.125	0.395	6.971E-7	219	0.028	0.128	4f9zA.pdb.gz
20	PDB:5xocB	0.104	0.667	8.735E-6	133	0.028	0.211	5xocB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PKC3	0.0	2036	985	1.000	1.000	TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens OX=9606 GN=TXNDC11 PE=1 SV=2
2	A2QFJ8	4.14e-12	72.4	515	0.067	0.128	A2QFJ8_ASPNC Protein disulfide-isomerase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=pdiA PE=3 SV=1
3	Q4WH99	8.12e-12	71.2	517	0.069	0.132	Q4WH99_ASPFU Protein disulfide-isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G06150 PE=3 SV=1
4	P34329	2.05e-11	70.1	618	0.043	0.068	PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2
5	Q8VX13	4.11e-11	69.3	579	0.040	0.067	PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-3 PE=2 SV=1
6	P27773	4.76e-11	68.9	505	0.052	0.101	PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus OX=10090 GN=Pdia3 PE=1 SV=2
7	P11598	5.51e-11	68.6	505	0.052	0.101	PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus OX=10116 GN=Pdia3 PE=1 SV=2
8	Q10057	5.72e-11	68.6	492	0.041	0.081	PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1F5.02 PE=3 SV=1
9	P30101	5.96e-11	68.6	505	0.043	0.083	PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4
10	V9HVY3	5.96e-11	68.6	505	0.043	0.083	V9HVY3_HUMAN Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=HEL-S-269 PE=2 SV=1
11	Q4VIT4	6.17e-11	68.6	505	0.043	0.083	PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops OX=9534 GN=PDIA3 PE=1 SV=1
12	Q9FF55	2.12e-10	67.0	597	0.045	0.074	PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana OX=3702 GN=PDIL1-4 PE=1 SV=1
13	Q95T75	2.53e-10	65.9	364	0.028	0.077	Q95T75_DROME Protein disulfide-isomerase OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=2 SV=1
14	Q3YMU0	3.97e-10	65.9	489	0.028	0.057	Q3YMU0_DROME Protein disulfide-isomerase (Fragment) OS=Drosophila melanogaster OX=7227 GN=ERp60 PE=1 SV=1
15	P13667	6.40e-10	65.5	645	0.038	0.057	PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2
16	G5ED07	7.80e-10	64.7	488	0.036	0.072	G5ED07_CAEEL Protein disulfide-isomerase OS=Caenorhabditis elegans OX=6239 GN=pdi-3 PE=1 SV=1
17	O48949	2.04e-09	63.5	532	0.038	0.070	O48949_CHLRE Protein disulfide-isomerase OS=Chlamydomonas reinhardtii OX=3055 GN=PDI PE=2 SV=1
18	P17967	5.61e-09	62.4	522	0.041	0.077	PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDI1 PE=1 SV=2
19	Q54EN4	6.79e-09	62.0	513	0.028	0.055	PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum OX=44689 GN=pdi2 PE=3 SV=1
20	P38659	1.15e-08	61.6	643	0.048	0.073	PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06472 ABC_membrane_2	2e+02	12.7	ABC transporter transmembrane region 2
2	PF08614 ATG16	0.0077	28.0	Autophagy protein 16 (ATG16)
3	PF05667 CCDC22	2.3e+02	12.0	Coiled-coil domain-containing protein 22
4	PF07989 Cnn_1N	4.6e+02	12.4	Centrosomin N-terminal motif 1
5	PF11932 DUF3450	4.6e+02	11.5	Protein of unknown function (DUF3450)
6	PF13870 DUF4201	7.8	17.7	Domain of unknown function (DUF4201)
7	PF05911 FPP	3.6e+02	10.8	Filament-like plant protein, long coiled-coil
8	PF13851 GAS	7.6e+02	10.9	Growth-arrest specific micro-tubule binding
9	PF14662 KASH_CCD	12	17.3	Coiled-coil region of CCDC155 or KASH
10	PF09726 Macoilin	1.7	18.8	Macoilin family
11	PF12631 MnmE_helical	1.9e+02	13.6	MnmE helical domain
12	PF15898 PRKG1_interact	5.4e+02	12.7	cGMP-dependent protein kinase interacting domain
13	PF17078 SHE3	1.1e+02	13.9	SWI5-dependent HO expression protein 3
14	PF00085 Thioredoxin	2.8e-21	86.8	Thioredoxin
15	PF13098 Thioredoxin_2	5.1e+02	12.5	Thioredoxin-like domain
16	PF13848 Thioredoxin_6	0.029	25.7	Thioredoxin-like domain
17	PF13899 Thioredoxin_7	0.46	22.0	Thioredoxin-like
18	PF13905 Thioredoxin_8	6.7	18.4	Thioredoxin-like
19	PF12325 TMF_TATA_bd	7.2e+02	11.7	TATA element modulatory factor 1 TATA binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000043609

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000030101	0.860	Calnexin
2	9598.ENSPTRP00000000984	0.799	Heat shock 70kDa protein 5 (Glucose-regulated protein, 78kDa)
3	9598.ENSPTRP00000002820	0.799	Uncharacterized protein
4	9598.ENSPTRP00000002821	0.799	Uncharacterized protein
5	9598.ENSPTRP00000007480	0.799	Hypoxia up-regulated 1
6	9598.ENSPTRP00000023036	0.795	alpha-1,2-Mannosidase
7	9598.ENSPTRP00000018010	0.793	Uncharacterized protein
8	9598.ENSPTRP00000018169	0.793	Uncharacterized protein
9	9598.ENSPTRP00000021730	0.778	DnaJ homolog subfamily C member 10
10	9598.ENSPTRP00000026437	0.749	Uncharacterized protein
11	9598.ENSPTRP00000044418	0.734	Sulfite oxidase
12	9598.ENSPTRP00000009129	0.719	Endoplasmin
13	9598.ENSPTRP00000008753	0.710	Osteosarcoma amplified 9, endoplasmic reticulum lectin
14	9598.ENSPTRP00000010762	0.707	Endoplasmic reticulum oxidoreductase alpha
15	9598.ENSPTRP00000042475	0.707	Uncharacterized protein
16	9598.ENSPTRP00000012019	0.704	Uncharacterized protein
17	9598.ENSPTRP00000043154	0.697	Microsomal triglyceride transfer protein
18	9598.ENSPTRP00000060491	0.668	Stannin
19	9598.ENSPTRP00000012236	0.661	Peptidyl-prolyl cis-trans isomerase
20	9598.ENSPTRP00000029385	0.661	Peptidyl-prolyl cis-trans isomerase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.595	catalytic activity
GO:1901363	0.353	heterocyclic compound binding
GO:0097159	0.336	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.722	biological regulation
GO:0050789	0.677	regulation of biological process
GO:0050794	0.642	regulation of cellular process
GO:0050896	0.580	response to stimulus
GO:0008152	0.500	metabolic process
GO:0051716	0.482	cellular response to stimulus
GO:0071704	0.461	organic substance metabolic process
GO:0006807	0.324	nitrogen compound metabolic process
GO:0044238	0.318	primary metabolic process
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005783	0.900	endoplasmic reticulum
GO:0016020	0.840	membrane
GO:0031974	0.762	membrane-enclosed lumen
GO:0070013	0.726	intracellular organelle lumen
GO:0005634	0.490	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]