StarFunc result for job id Q6PKG0

User Input

>input (1096 residues)
MATQVEPLLPGGATLLQAEEHGGLVRKKPPPAPEGKGEPGPNDVRGGEPDGSARRPRPPC
AKPHKEGTGQQERESPRPLQLPGAEGPAISDGEEGGGEPGAGGGAAGAAGAGRRDFVEAP
PPKVNPWTKNALPPVLTTVNGQSPPEHSAPAKVVRAAVPKQRKGSKVGDFGDAINWPTPG
EIAHKSVQPQSHKPQPTRKLPPKKDMKEQEKGEGSDSKESPKTKSDESGEEKNGDEDCQR
GGQKKKGNKHKWVPLQIDMKPEVPREKLASRPTRPPEPRHIPANRGEIKGSESATYVPVA
PPTPAWQPEIKPEPAWHDQDETSSVKSDGAGGARASFRGRGRGRGRGRGRGRGGTRTHFD
YQFGYRKFDGVEGPRTPKYMNNITYYFDNVSSTELYSVDQELLKDYIKRQIEYYFSVDNL
ERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEIVDEKVRRREEP
EKWPLPPIVDYSQTDFSQLLNCPEFVPRQHYQKETESAPGSPRAVTPVPTKTEEVSNLKT
LPKGLSASLPDLDSENWIEVKKRPRPSPARPKKSEESRFSHLTSLPQQLPSQQLMSKDQD
EQEELDFLFDEEMEQMDGRKNTFTAWSDEESDYEIDDRDVNKILIVTQTPHYMRRHPGGD
RTGNHTSRAKMSAELAKVINDGLFYYEQDLWAEKFEPEYSQIKQEVENFKKVNMISREQF
DTLTPEPPVDPNQEVPPGPPRFQQVPTDALANKLFGAPEPSTIARSLPTTVPESPNYRNT
RTPRTPRTPQLKDSSQTSRFYPVVKEGRTLDAKMPRKRKTRHSSNPPLESHVGWVMDSRE
HRPRTASISSSPSEGTPTVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNE
RKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSY
GLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRR
LEDFRVDPPMGEEGNHKRHSVVAGGGGGEGRKRCPSQSSSRPAAMISQPPTPPTGQPVRE
DAKWTSQHSNTQTLGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PKG0	0.999	0.999	0.000	1096	1.000	1.000	Q6PKG0.pdb.gz	LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2
2	AFDB:Q9VAW5	0.195	0.139	4.935E-43	1673	0.374	0.245	Q9VAW5.pdb.gz	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
3	AFDB:P78332	0.042	0.042	1.119E-4	1123	0.143	0.140	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
4	AFDB:Q9C0I3	0.041	0.047	1.802E-3	900	0.114	0.139	Q9C0I3.pdb.gz	CCSE1_HUMAN Serine-rich coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CCSER1 PE=1 SV=2
5	AFDB:Q8IHQ2	0.049	0.043	2.343E-3	1301	0.104	0.088	Q8IHQ2.pdb.gz	Q8IHQ2_PLAF7 Oocyst rupture protein 1, putative OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1146600 PE=3 SV=1
6	AFDB:P34545	0.049	0.043	4.171E-3	2017	0.130	0.071	P34545.pdb.gz	CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans OX=6239 GN=cbp-1 PE=1 SV=6
7	AFDB:B0M0P8	0.065	0.043	4.632E-3	2356	0.092	0.043	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
8	AFDB:A0A0A0MR80	0.046	0.050	1.393E-2	985	0.154	0.172	A0A0A0MR80.pdb.gz	A0A0A0MR80_HUMAN E1A binding protein p400 OS=Homo sapiens OX=9606 GN=EP400 PE=1 SV=1
9	AFDB:R9PY21	0.041	0.059	2.234E-2	720	0.090	0.138	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
10	AFDB:Q86SQ0	0.037	0.034	2.481E-2	1253	0.085	0.074	Q86SQ0.pdb.gz	PHLB2_HUMAN Pleckstrin homology-like domain family B member 2 OS=Homo sapiens OX=9606 GN=PHLDB2 PE=1 SV=2
11	PDB:7mq8LL	0.049	0.084	6.831E-1	510	0.028	0.061	7mq8LL.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6hivBI	0.077	0.216	1.850	319	0.020	0.069	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
13	PDB:7dvqK	0.090	0.382	2.055	188	0.019	0.112	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:7ungX	0.056	0.083	2.165	701	0.010	0.016	7ungX.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:5loeA	0.049	0.154	3.126	258	0.013	0.054	5loeA.pdb.gz	Structure of the Branched-chain Amino Acid and GTP-sensing Global Regulator, CodY, from Bacillus subtilis.
16	PDB:7rroX	0.052	0.081	3.126	636	0.011	0.019	7rroX.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7k36A	0.093	0.173	3.294	554	0.012	0.023	7k36A.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
18	PDB:1x19A	0.050	0.130	3.856	350	0.010	0.031	1x19A.pdb.gz
19	PDB:7ungi	0.037	0.136	4.063	250	0.039	0.172	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
20	PDB:3euhC	0.048	0.193	4.282	206	0.012	0.063	3euhC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q659C4	0.0	974	914	0.495	0.594	LAR1B_HUMAN La-related protein 1B OS=Homo sapiens OX=9606 GN=LARP1B PE=1 SV=2
2	Q6PKG0	0.0	2251	1096	1.000	1.000	LARP1_HUMAN La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2
3	Q9VAW5	4.99e-122	413	1673	0.205	0.134	LARP_DROME La-related protein 1 OS=Drosophila melanogaster OX=7227 GN=larp PE=1 SV=5
4	D5MCN2	2.95e-100	345	1150	0.219	0.209	LARP1_CAEEL La-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=larp-1 PE=4 SV=2
5	Q940X9	2.72e-57	215	826	0.099	0.131	LRP1A_ARATH La-related protein 1A OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
6	F4K704	1.31e-56	213	833	0.097	0.127	F4K704_ARATH LA RNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=LARP1A PE=1 SV=1
7	Q9P6K0	2.19e-17	89.0	475	0.082	0.189	YLA3_SCHPO Uncharacterized HTH La-type RNA-binding protein C1527.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1527.03 PE=1 SV=1
8	Q8RWR2	7.90e-17	87.0	452	0.036	0.088	LRP1B_ARATH La-related protein 1B OS=Arabidopsis thaliana OX=3702 GN=LARP1B PE=1 SV=2
9	Q71RC2	1.50e-13	77.4	724	0.041	0.062	LARP4_HUMAN La-related protein 4 OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=3
10	Q96J85	5.31e-13	74.3	375	0.041	0.120	Q96J85_HUMAN C-Mpl binding protein OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=1
11	Q94K80	8.18e-13	74.7	523	0.030	0.063	LRP1C_ARATH La-related protein 1C OS=Arabidopsis thaliana OX=3702 GN=LARP1C PE=1 SV=1
12	Q6P4E2	8.94e-13	73.6	374	0.041	0.120	Q6P4E2_HUMAN LARP4 protein OS=Homo sapiens OX=9606 GN=LARP4 PE=1 SV=1
13	Q9I7T7	3.49e-12	73.6	1531	0.029	0.021	LAR4_DROME La-related protein Larp4B OS=Drosophila melanogaster OX=7227 GN=Larp4B PE=1 SV=2
14	P40796	2.21e-11	69.3	390	0.034	0.095	LA_DROME La protein homolog OS=Drosophila melanogaster OX=7227 GN=La PE=1 SV=2
15	Q7ZWE3	1.34e-10	67.8	555	0.037	0.074	LARP7_DANRE La-related protein 7 OS=Danio rerio OX=7955 GN=larp7 PE=2 SV=1
16	P25567	1.55e-10	67.0	434	0.030	0.076	SRO9_YEAST RNA-binding protein SRO9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRO9 PE=1 SV=2
17	P05455	1.60e-10	67.0	408	0.036	0.096	LA_HUMAN Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2
18	Q54TG6	5.03e-10	65.1	354	0.035	0.107	Q54TG6_DICDI Lupus La protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0281763 PE=1 SV=1
19	P32067	1.88e-09	63.5	415	0.034	0.089	LA_MOUSE Lupus La protein homolog OS=Mus musculus OX=10090 GN=Ssb PE=1 SV=1
20	P38656	3.49e-09	62.8	415	0.034	0.089	LA_RAT Lupus La protein homolog OS=Rattus norvegicus OX=10116 GN=Ssb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05383 La	4.1e-17	73.2	La domain
2	PF17228 SGP	39	16.5	Sulphur globule protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000006039

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000015137	0.793	Eukaryotic translation initiation factor 4 gamma, 1
2	9555.ENSPANP00000002017	0.730	Uncharacterized protein
3	9555.ENSPANP00000000588	0.716	Binds the poly(A) tail of mRNA.
4	9555.ENSPANP00000008312	0.716	annotation not available
5	9555.ENSPANP00000016297	0.711	Regulatory associated protein of MTOR, complex 1
6	9555.ENSPANP00000011671	0.707	Eukaryotic translation initiation factor 4 gamma, 3
7	9555.ENSPANP00000017677	0.683	Binds the poly(A) tail of mRNA.
8	9555.ENSPANP00000010891	0.666	Binds the poly(A) tail of mRNA.
9	9555.ENSPANP00000018781	0.644	Gse1 coiled-coil protein
10	9555.ENSPANP00000008489	0.637	Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction
11	9555.ENSPANP00000008071	0.591	NOP58 ribonucleoprotein
12	9555.ENSPANP00000000848	0.587	poly(A) binding protein interacting protein 1
13	9555.ENSPANP00000008341	0.587	Eukaryotic translation initiation factor 4 gamma, 2
14	9555.ENSPANP00000018519	0.586	Uncharacterized protein
15	9555.ENSPANP00000015087	0.566	poly(A) binding protein, cytoplasmic 5
16	9555.ENSPANP00000015088	0.566	annotation not available
17	9555.ENSPANP00000015387	0.566	Nucleolin
18	9555.ENSPANP00000013299	0.563	Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis. The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF- 2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joi [...]
19	9555.ENSPANP00000010967	0.560	Transmembrane protein 206
20	9555.ENSPANP00000014896	0.558	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043024	1.000	ribosomal small subunit binding
GO:0008494	1.000	translation activator activity
GO:0048027	0.999	mRNA 5'-UTR binding
GO:0003730	0.998	mRNA 3'-UTR binding
GO:0045296	0.997	cadherin binding
GO:0008190	0.997	eukaryotic initiation factor 4E binding
GO:0000340	0.997	RNA 7-methylguanosine cap binding
GO:0008135	0.484	translation factor activity, RNA binding
GO:0003743	0.407	translation initiation factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006417	0.986	regulation of translation
GO:0044238	0.984	primary metabolic process
GO:0006446	0.983	regulation of translational initiation
GO:0010467	0.981	gene expression
GO:0034641	0.981	cellular nitrogen compound metabolic process
GO:0031325	0.973	positive regulation of cellular metabolic process
GO:0044260	0.972	cellular macromolecule metabolic process
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:1901564	0.968	organonitrogen compound metabolic process
GO:0031324	0.957	negative regulation of cellular metabolic process
GO:0051172	0.956	negative regulation of nitrogen compound metabolic process
GO:0031329	0.952	regulation of cellular catabolic process
GO:0019538	0.949	protein metabolic process
GO:0043043	0.945	peptide biosynthetic process
GO:0006413	0.943	translational initiation
GO:0045727	0.931	positive regulation of translation
GO:1903311	0.922	regulation of mRNA metabolic process
GO:0010605	0.921	negative regulation of macromolecule metabolic process
GO:0006950	0.893	response to stress
GO:0043487	0.886	regulation of RNA stability
GO:0009895	0.877	negative regulation of catabolic process
GO:0010629	0.871	negative regulation of gene expression
GO:0031330	0.855	negative regulation of cellular catabolic process
GO:0061013	0.852	regulation of mRNA catabolic process
GO:0051716	0.845	cellular response to stimulus
GO:0043488	0.822	regulation of mRNA stability
GO:0051253	0.796	negative regulation of RNA metabolic process
GO:1902369	0.767	negative regulation of RNA catabolic process
GO:0043489	0.738	RNA stabilization
GO:0051248	0.715	negative regulation of protein metabolic process
GO:1903312	0.696	negative regulation of mRNA metabolic process
GO:0009896	0.596	positive regulation of catabolic process
GO:1902373	0.584	negative regulation of mRNA catabolic process
GO:0034249	0.420	negative regulation of amide metabolic process
GO:0010558	0.398	negative regulation of macromolecule biosynthetic process
GO:0010033	0.394	response to organic substance
GO:0031327	0.394	negative regulation of cellular biosynthetic process
GO:0009605	0.385	response to external stimulus
GO:2000113	0.372	negative regulation of cellular macromolecule biosynthetic process
GO:0007154	0.365	cell communication
GO:1901700	0.355	response to oxygen-containing compound
GO:0017148	0.354	negative regulation of translation
GO:1901654	0.343	response to ketone
GO:0031331	0.324	positive regulation of cellular catabolic process
GO:0071495	0.310	cellular response to endogenous stimulus
GO:0010506	0.310	regulation of autophagy
GO:0048255	0.310	mRNA stabilization
GO:0070887	0.305	cellular response to chemical stimulus
GO:0071310	0.300	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0016020	0.998	membrane
GO:0032991	0.997	protein-containing complex
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0036464	0.994	cytoplasmic ribonucleoprotein granule
GO:1990904	0.991	ribonucleoprotein complex
GO:0010494	0.977	cytoplasmic stress granule
GO:0038201	0.886	TOR complex
GO:0043231	0.877	intracellular membrane-bounded organelle
GO:0005634	0.857	nucleus
GO:0005844	0.845	polysome
GO:0031931	0.833	TORC1 complex
GO:0005840	0.658	ribosome
GO:0042788	0.614	polysomal ribosome
GO:0031974	0.548	membrane-enclosed lumen
GO:0070013	0.544	intracellular organelle lumen
GO:0031981	0.506	nuclear lumen
GO:0005654	0.347	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]