StarFunc result for job id Q6PL18

User Input

>input (1390 residues)
MVVLRSSLELHNHSAASATGSLDLSSDFLSLEHIGRRRLRSAGAAQKKPAATTAKAGDGS
SVKEVETYHRTRALRSLRKDAQNSSDSSFEKNVEITEQLANGRHFTRQLARQQADKKKEE
HREDKVIPVTRSLRARNIVQSTEHLHEDNGDVEVRRSCRIRSRYSGVNQSMLFDKLITNT
AEAVLQKMDDMKKMRRQRMRELEDLGVFNETEESNLNMYTRGKQKDIQRTDEETTDNQEG
SVESSEEGEDQEHEDDGEDEDDEDDDDDDDDDDDDDDEDDEDEEDGEEENQKRYYLRQRK
ATVYYQAPLEKPRHQRKPNIFYSGPASPARPRYRLSSAGPRSPYCKRMNRRRHAIHSSDS
TSSSSSEDEQHFERRRKRSRNRAINRCLPLNFRKDELKGIYKDRMKIGASLADVDPMQLD
SSVRFDSVGGLSNHIAALKEMVVFPLLYPEVFEKFKIQPPRGCLFYGPPGTGKTLVARAL
ANECSQGDKRVAFFMRKGADCLSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLAPVR
SSRQDQIHSSIVSTLLALMDGLDSRGEIVVIGATNRLDSIDPALRRPGRFDREFLFSLPD
KEARKEILKIHTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYT
TSEKLQLDLSSINISAKDFEVAMQKMIPASQRAVTSPGQALSTVVKPLLQNTVDKILEAL
QRVFPHAEFRTNKTLDSDISCPLLESDLAYSDDDVPSVYENGLSQKSSHKAKDNFNFLHL
NRNACYQPMSFRPRILIVGEPGFGQGSHLAPAVIHALEKFTVYTLDIPVLFGVSTTSPEE
TCAQVIREAKRTAPSIVYVPHIHVWWEIVGPTLKATFTTLLQNIPSFAPVLLLATSDKPH
SALPEEVQELFIRDYGEIFNVQLPDKEERTKFFEDLILKQAAKPPISKKKAVLQALEVLP
VAPPPEPRSLTAEEVKRLEEQEEDTFRELRIFLRNVTHRLAIDKRFRVFTKPVDPDEVPD
YVTVIKQPMDLSSVISKIDLHKYLTVKDYLRDIDLICSNALEYNPDRDPGDRLIRHRACA
LRDTAYAIIKEELDEDFEQLCEEIQESRKKRGCSSSKYAPSYYHVMPKQNSTLVGDKRSD
PEQNEKLKTPSTPVACSTPAQLKRKIRKKSNWYLGTIKKRRKISQAKDDSQNAIDHKIES
DTEETQDTSVDHNETGNTGESSVEENEKQQNASESKLELRNNSNTCNIENELEDSRKTTA
CTELRDKIACNGDASSSQIIHISDENEGKEMCVLRMTRARRSQVEQQQLITVEKALAILS
QPTPSLVVDHERLKNLLKTVVKKSQNYNIFQLENLYAVISQCIYRHRKDHDKTSLIQKME
QEVENFSCSR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PL18	1.000	1.000	0.000	1390	1.000	1.000	Q6PL18.pdb.gz	ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1
2	AFDB:F4IAE9	0.403	0.453	2.984E-73	1210	0.299	0.343	F4IAE9.pdb.gz	Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana OX=3702 GN=At1g05910 PE=2 SV=1
3	PDB:6jq0E	0.333	0.771	2.585E-45	577	0.178	0.430	6jq0E.pdb.gz	Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.
4	PDB:6jq0F	0.306	0.775	1.516E-38	524	0.168	0.445	6jq0F.pdb.gz	Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.
5	PDB:6jq0A	0.306	0.786	4.865E-37	516	0.160	0.432	6jq0A.pdb.gz	Structural basis of nucleosome assembly by the Abo1 AAA+ ATPase histone chaperone.
6	PDB:7vcsA	0.275	0.471	5.766E-30	766	0.112	0.202	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
7	PDB:7ln6F	0.177	0.335	5.009E-29	714	0.109	0.211	7ln6F.pdb.gz	Mechanistic insight into substrate processing and allosteric inhibition of human p97.
8	PDB:6opcB	0.260	0.451	6.772E-29	741	0.109	0.204	6opcB.pdb.gz	Structure of the Cdc48 segregase in the act of unfolding an authentic substrate.
9	PDB:7z11D	0.258	0.454	1.592E-28	734	0.098	0.185	7z11D.pdb.gz	Visualizing maturation factor extraction from the nascent ribosome by the AAA-ATPase Drg1.
10	PDB:5ifwB	0.178	0.338	4.013E-26	702	0.104	0.205	5ifwB.pdb.gz	Quantitative interaction mapping reveals an extended UBX domain in ASPL that disrupts functional p97 hexamers.
11	PDB:7mhsE	0.256	0.656	1.002E-24	489	0.103	0.292	7mhsE.pdb.gz	Active conformation of the p97-p47 unfoldase complex.
12	PDB:6oaaE	0.255	0.710	1.424E-24	442	0.109	0.344	6oaaE.pdb.gz	Substrate processing by the Cdc48 ATPase complex is initiated by ubiquitin unfolding.
13	AFDB:A0A0D9SF58	0.137	0.156	1.378E-9	1184	0.121	0.142	A0A0D9SF58.pdb.gz	A0A0D9SF58_HUMAN Chromosome transmission fidelity factor 18 OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1
14	AFDB:Q54Q16	0.073	0.060	2.675E-8	1917	0.140	0.102	Q54Q16.pdb.gz	Q54Q16_DICDI Chromo domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0284171 PE=4 SV=1
15	AFDB:A0A0R4IJ25	0.069	0.063	2.958E-8	1604	0.121	0.105	A0A0R4IJ25.pdb.gz
16	AFDB:Q9Y794	0.122	0.164	7.765E-7	972	0.079	0.113	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
17	AFDB:Q9GQN5	0.087	0.091	8.165E-7	1311	0.122	0.129	Q9GQN5.pdb.gz	ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster OX=7227 GN=XNP PE=1 SV=2
18	AFDB:Q3TKT4	0.068	0.058	8.586E-7	1613	0.126	0.108	Q3TKT4.pdb.gz	SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus OX=10090 GN=Smarca4 PE=1 SV=1
19	AFDB:Q6DIC0	0.070	0.064	5.245E-6	1577	0.129	0.114	Q6DIC0.pdb.gz	SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus OX=10090 GN=Smarca2 PE=1 SV=1
20	AFDB:E9PTG1	0.064	0.059	1.233E-5	1597	0.122	0.106	E9PTG1.pdb.gz	E9PTG1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2 OS=Rattus norvegicus OX=10116 GN=Smarca2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J211	0.0	1466	708	0.509	1.000	A0A0B4J211_HUMAN ATPase family AAA domain containing 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1
2	F4IAE9	0.0	574	1210	0.224	0.257	Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana OX=3702 GN=At1g05910 PE=2 SV=1
3	P54816	0.0	586	1291	0.237	0.255	TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans OX=6239 GN=lex-1 PE=1 SV=3
4	Q6PL18	0.0	2877	1390	1.000	1.000	ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1
5	Q8CDM1	0.0	1796	1040	0.646	0.863	ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus OX=10090 GN=Atad2 PE=1 SV=1
6	Q9ULI0	0.0	1171	1458	0.446	0.425	ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B PE=1 SV=4
7	O14114	2.37e-155	503	1190	0.214	0.250	ATD2_SCHPO ATPase histone chaperone abo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo1 PE=1 SV=1
8	P40340	3.45e-141	469	1379	0.206	0.208	ATAD2_YEAST ATPase histone chaperone YTA7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YTA7 PE=1 SV=2
9	H7BYF1	2.89e-140	449	734	0.171	0.324	H7BYF1_HUMAN ATPase family AAA domain containing 2B (Fragment) OS=Homo sapiens OX=9606 GN=ATAD2B PE=1 SV=1
10	Q9C0W2	4.93e-139	459	1201	0.197	0.228	ATD22_SCHPO ATPase with bromodomain protein abo2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=abo2 PE=3 SV=1
11	Q385D4	3.50e-93	331	1271	0.122	0.133	Q385D4_TRYB2 AAA ATPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4210 PE=3 SV=1
12	F4IXH3	8.52e-83	303	1954	0.117	0.083	F4IXH3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=BRP1 PE=1 SV=1
13	P54812	1.56e-63	235	810	0.093	0.159	TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.2 PE=1 SV=2
14	P25694	2.51e-63	235	835	0.086	0.144	CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC48 PE=1 SV=3
15	Q6FNS8	2.95e-63	234	830	0.086	0.145	Q6FNS8_CANGA Candida glabrata strain CBS138 chromosome J complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CDC48 PE=4 SV=1
16	P54811	3.01e-63	234	809	0.092	0.158	TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans OX=6239 GN=cdc-48.1 PE=1 SV=1
17	Q59WG3	7.45e-63	233	826	0.086	0.144	Q59WG3_CANAL AAA family ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC48 PE=4 SV=1
18	Q7ZU99	8.69e-63	233	806	0.086	0.148	TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio OX=7955 GN=vcp PE=1 SV=1
19	P23787	2.00e-62	231	805	0.086	0.148	TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis OX=8355 GN=vcp PE=1 SV=3
20	P46462	2.37e-62	231	806	0.086	0.148	TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus OX=10116 GN=Vcp PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.6e-43	159.7	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.11	24.4	AAA ATPase domain
3	PF13238 AAA_18	6.1	18.8	AAA domain
4	PF07724 AAA_2	0.11	24.1	AAA domain (Cdc48 subfamily)
5	PF13401 AAA_22	3.4	19.4	AAA domain
6	PF07728 AAA_5	36	15.8	AAA domain (dynein-related subfamily)
7	PF12775 AAA_7	2.4e+02	12.6	P-loop containing dynein motor region
8	PF17862 AAA_lid_3	3.2e-08	44.6	AAA+ lid domain
9	PF00439 Bromodomain	8.4e-13	59.5	Bromodomain
10	PF01695 IstB_IS21	13	16.7	IstB-like ATP binding protein
11	PF05729 NACHT	3.8e+02	12.4	NACHT domain
12	PF00910 RNA_helicase	35	16.2	RNA helicase
13	PF05496 RuvB_N	1.3e+02	13.7	Holliday junction DNA helicase RuvB P-loop domain
14	PF05764 YL1	1.1	20.8	YL1 nuclear protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000287394

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244537	0.976	Histone cluster 1 H4 family member f
2	9606.ENSP00000405330	0.973	Estrogen receptor
3	9606.ENSP00000367034	0.910	Histone cluster 1 H4 family member c
4	9606.ENSP00000484789	0.891	Histone H4
5	9606.ENSP00000347168	0.882	Histone cluster 1 H4 family member j
6	9606.ENSP00000366956	0.882	Histone cluster 1 H4 family member h
7	9606.ENSP00000366974	0.882	Histone cluster 1 H4 family member b
8	9606.ENSP00000443017	0.882	Histone cluster 4, H4
9	9606.ENSP00000462355	0.882	Histone cluster 2 H4 family member b
10	9606.ENSP00000462667	0.882	Histone cluster 2 H4 family member a
11	9606.ENSP00000479106	0.882	Histone cluster 1 H4 family member a
12	9606.ENSP00000479461	0.882	Histone cluster 1 H4 family member d
13	9606.ENSP00000479794	0.882	Histone cluster 1 H4 family member k
14	9606.ENSP00000480960	0.882	Histone cluster 1 H4 family member l
15	9606.ENSP00000481486	0.882	Histone cluster 1 H4 family member i
16	9606.ENSP00000411532	0.872	DNA topoisomerase 2-alpha
17	9606.ENSP00000260731	0.836	Kinesin-like protein KIF11
18	9606.ENSP00000356379	0.836	Abnormal spindle-like microcephaly-associated protein
19	9606.ENSP00000353770	0.831	Ribonucleoside-diphosphate reductase subunit M2
20	9606.ENSP00000228843	0.829	RAD51-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016887	0.999	ATP hydrolysis activity
GO:0140096	0.743	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.989	regulation of primary metabolic process
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0048518	0.988	positive regulation of biological process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0010604	0.980	positive regulation of macromolecule metabolic process
GO:0045935	0.975	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.967	regulation of DNA-templated transcription
GO:0031328	0.898	positive regulation of cellular biosynthetic process
GO:1902680	0.890	positive regulation of RNA biosynthetic process
GO:0045893	0.865	positive regulation of DNA-templated transcription
GO:0009987	0.798	cellular process
GO:0071840	0.498	cellular component organization or biogenesis
GO:0016043	0.491	cellular component organization
GO:0008152	0.362	metabolic process
GO:0071704	0.332	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.639	cytoplasm
GO:0043232	0.389	intracellular non-membrane-bounded organelle
GO:0005576	0.331	extracellular region
GO:0005829	0.314	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	0.999	ATP + H2O = ADP + H(+) + phosphate

[back to server]