StarFunc result for job id Q6PML9

User Input

>input (568 residues)
MLPGLAAAAAHRCSWSSLCRLRLRCRAAACNPSDRQEWQNLVTFGSFSNMVPCSHPYIGT
LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQVRVKAVLKKRE
YGSKYTQNNFITGVRAINEFCLKSSDLEQLRKIRRRSPHEDTESFTVYLRSDVEAKSLEV
WGSPEALAREKKLRKEAEIEYRERLFRNQKILREYRDFLGNTKPRSRTASVFFKGPGKVV
MVAICINGLNCFFKFLAWIYTGSASMFSEAIHSLSDTCNQGLLALGISKSVQTPDPSHPY
GFSNMRYISSLISGVGIFMMGAGLSWYHGVMGLLHPQPIESLLWAYCILAGSLVSEGATL
LVAVNELRRNARAKGMSFYKYVMESRDPSTNVILLEDTAAVLGVIIAATCMGLTSITGNP
LYDSLGSLGVGTLLGMVSAFLIYTNTEALLGRSIQPEQVQRLTELLENDPSVRAIHDVKA
TDLGLGKVRFKAEVDFDGRVVTRSYLEKQDFDQMLQEIQEVKTPEELETFMLKHGENIID
TLGAEVDRLEKELKKRNPEVRHVDLEIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PML9	1.000	1.000	2.845E-77	568	1.000	1.000	Q6PML9.pdb.gz	ZNT9_HUMAN Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1
2	AFDB:Q55E98	0.423	0.394	1.597E-11	614	0.102	0.094	Q55E98.pdb.gz	Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269332 PE=3 SV=1
3	AFDB:Q6IVC2	0.124	0.141	2.030E-3	472	0.123	0.148	Q6IVC2.pdb.gz	TGAL1_ORYSJ Transcription factor TGAL1 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL1 PE=1 SV=2
4	PDB:7ad8G	0.136	0.525	3.245E-3	134	0.055	0.231	7ad8G.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
5	AFDB:Q5N7C7	0.102	0.107	5.566E-3	539	0.127	0.134	Q5N7C7.pdb.gz	LG2_ORYSJ Transcription factor LG2 OS=Oryza sativa subsp. japonica OX=39947 GN=LG2 PE=1 SV=1
6	PDB:5lclB	0.127	0.577	6.758E-3	114	0.028	0.140	5lclB.pdb.gz	Structural Insights into the Recognition of N(2) -Aryl- and C8-Aryl DNA Lesions by the Repair Protein XPA/Rad14.
7	AFDB:Q9SX27	0.115	0.133	1.107E-2	452	0.114	0.144	Q9SX27.pdb.gz	PAN_ARATH Transcription factor PERIANTHIA OS=Arabidopsis thaliana OX=3702 GN=PAN PE=1 SV=1
8	AFDB:O69657	0.142	0.167	1.833E-2	451	0.102	0.129	O69657.pdb.gz	O69657_MYCTO Transmembrane protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3791 PE=4 SV=1
9	AFDB:Q9D709	0.119	0.157	2.646E-2	391	0.116	0.169	Q9D709.pdb.gz	TMM79_MOUSE Transmembrane protein 79 OS=Mus musculus OX=10090 GN=Tmem79 PE=1 SV=1
10	AFDB:A1MMZ0	0.110	0.111	5.510E-2	563	0.102	0.103	A1MMZ0.pdb.gz
11	AFDB:Q8T043	0.165	0.117	7.255E-2	894	0.111	0.070	Q8T043.pdb.gz	Q8T043_DROME Chaski, isoform A OS=Drosophila melanogaster OX=7227 GN=chk PE=2 SV=1
12	AFDB:A0A2R8QR22	0.095	0.108	8.715E-2	483	0.100	0.118	A0A2R8QR22.pdb.gz
13	PDB:6nwdA	0.141	0.267	9.654E-2	246	0.049	0.114	6nwdA.pdb.gz	X-ray Crystallographic Structure and Oligomerization of Gloeobacter Rhodopsin.
14	PDB:4xesA	0.142	0.166	1.108E-1	471	0.069	0.083	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
15	PDB:6wtiC	0.141	0.296	1.459E-1	186	0.044	0.134	6wtiC.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
16	PDB:7stmA	0.088	0.068	2.415E-1	801	0.053	0.037	7stmA.pdb.gz	Structural basis for inhibition and regulation of a chitin synthase from Candida albicans.
17	PDB:5zbqA	0.115	0.135	3.329E-1	463	0.055	0.067	5zbqA.pdb.gz	Structural basis of ligand binding modes at the neuropeptide Y Y1receptor
18	PDB:7nacn	0.082	0.101	3.329E-1	425	0.055	0.073	7nacn.pdb.gz	Sequence-specific remodeling of a topologically complex RNP substrate by Spb4.
19	PDB:7oseB	0.136	0.169	3.329E-1	377	0.058	0.088	7oseB.pdb.gz	Structure of Escherichia coli cytochrome bd-II type oxidase with bound aurachin D.
20	PDB:7sqoR	0.146	0.261	3.329E-1	270	0.060	0.126	7sqoR.pdb.gz	Molecular mechanism of the wake-promoting agent TAK-925.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5IRJ6	0.0	1024	567	0.889	0.891	ZNT9_MOUSE Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Mus musculus OX=10090 GN=Slc30a9 PE=1 SV=2
2	Q6PML9	0.0	1177	568	1.000	1.000	ZNT9_HUMAN Proton-coupled zinc antiporter SLC30A9, mitochondrial OS=Homo sapiens OX=9606 GN=SLC30A9 PE=1 SV=1
3	V6F510	1.58e-14	76.6	297	0.120	0.229	MAMB_MAGGM Magnetosome protein MamB OS=Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) OX=431944 GN=mamB PE=1 SV=1
4	Q8VLX7	3.71e-09	60.5	291	0.102	0.199	Q8VLX7_THETH CzrB protein OS=Thermus thermophilus OX=274 GN=czrB PE=1 SV=1
5	P69380	7.98e-07	53.5	300	0.100	0.190	FIEF_ECOLI Cation-efflux pump FieF OS=Escherichia coli (strain K12) OX=83333 GN=fieF PE=1 SV=1
6	V6F235	7.90e-06	50.4	318	0.111	0.198	MAMM_MAGGM Magnetosome protein MamM OS=Magnetospirillum gryphiswaldense (strain DSM 6361 / JCM 21280 / NBRC 15271 / MSR-1) OX=431944 GN=mamM PE=1 SV=1
7	Q03218	3.21e-05	48.9	510	0.040	0.045	MMT1_YEAST Mitochondrial metal transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMT1 PE=1 SV=1
8	Q08970	3.22e-05	48.9	484	0.129	0.151	MMT2_YEAST Mitochondrial metal transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMT2 PE=3 SV=2
9	P23025	4.76e-05	47.8	273	0.049	0.103	XPA_HUMAN DNA repair protein complementing XP-A cells OS=Homo sapiens OX=9606 GN=XPA PE=1 SV=1
10	D4A981	4.87e-05	47.4	241	0.051	0.120	D4A981_RAT XPA, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpa PE=3 SV=1
11	A0A8I6G6T5	1.12e-04	46.6	273	0.051	0.106	A0A8I6G6T5_RAT XPA, DNA damage recognition and repair factor OS=Rattus norvegicus OX=10116 GN=Xpa PE=3 SV=1
12	P27088	1.69e-04	45.8	267	0.048	0.101	XPA_XENLA DNA repair protein complementing XP-A cells homolog OS=Xenopus laevis OX=8355 GN=xpa PE=2 SV=1
13	Q64267	2.22e-04	45.8	272	0.049	0.103	XPA_MOUSE DNA repair protein complementing XP-A cells homolog OS=Mus musculus OX=10090 GN=Xpa PE=1 SV=2
14	P28518	8.20e-04	43.9	296	0.051	0.098	XPA_DROME DNA repair protein complementing XP-A cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpac PE=2 SV=3
15	P27089	0.002	43.1	267	0.051	0.109	XPA_CHICK DNA repair protein complementing XP-A cells homolog OS=Gallus gallus OX=9031 GN=XPA PE=2 SV=1
16	Q9HGQ3	0.16	37.4	732	0.065	0.051	CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cis4 PE=1 SV=1
17	P08201	0.37	36.2	847	0.067	0.045	NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) OX=83333 GN=nirB PE=3 SV=4
18	Q86XR2	0.95	35.0	697	0.062	0.050	NIBA3_HUMAN Protein Niban 3 OS=Homo sapiens OX=9606 GN=NIBAN3 PE=1 SV=2
19	Q21302	1.2	33.9	241	0.048	0.112	Q21302_CAEEL XPA C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=xpa-1 PE=1 SV=1
20	Q8T0G1	3.5	33.1	498	0.046	0.052	Q8T0G1_DROME LD05335p OS=Drosophila melanogaster OX=7227 GN=ZnT41F PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01545 Cation_efflux	4.9e-28	109.8	Cation efflux family
2	PF12137 RapA_C	54	14.3	RNA polymerase recycling family C-terminal
3	PF05181 XPA_C	1	20.6	XPA protein C-terminus
4	PF16916 ZT_dimer	1.5e+02	13.9	Dimerisation domain of Zinc Transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264451

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368648	0.908	Zinc transporter 6
2	9606.ENSP00000379836	0.891	Zinc transporter 5
3	9606.ENSP00000261867	0.890	Zinc transporter 4
4	9606.ENSP00000359130	0.879	Zinc transporter 7
5	9606.ENSP00000355968	0.858	Zinc transporter 1
6	9606.ENSP00000336887	0.855	Zinc transporter ZIP9
7	9606.ENSP00000363394	0.851	Solute carrier family 30 member 2
8	9606.ENSP00000355893	0.840	Zinc transporter 10
9	9606.ENSP00000445829	0.832	Zinc transporter ZIP11
10	9606.ENSP00000233535	0.827	Zinc transporter 3
11	9606.ENSP00000354689	0.820	Zinc transporter ZIP13
12	9606.ENSP00000352779	0.814	Zinc transporter ZIP14
13	9606.ENSP00000363809	0.792	Zinc transporter SLC39A7
14	9606.ENSP00000269187	0.785	Zinc transporter ZIP6
15	9606.ENSP00000366586	0.785	Zinc transporter ZIP12
16	9606.ENSP00000386766	0.775	Zinc transporter ZIP10
17	9606.ENSP00000415011	0.771	Zinc transporter 8
18	9606.ENSP00000266980	0.764	Zinc transporter ZIP5
19	9606.ENSP00000357612	0.758	Zinc transporter ZIP1
20	9606.ENSP00000301305	0.755	Zinc transporter ZIP4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0030374	0.999	nuclear receptor coactivator activity
GO:0061629	0.999	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0022857	0.980	transmembrane transporter activity
GO:0016922	0.925	nuclear receptor binding
GO:0046873	0.885	metal ion transmembrane transporter activity
GO:1901702	0.860	salt transmembrane transporter activity
GO:0046915	0.547	transition metal ion transmembrane transporter activity
GO:0005385	0.519	zinc ion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0000041	0.946	transition metal ion transport
GO:0006829	0.941	zinc ion transport
GO:0071704	0.935	organic substance metabolic process
GO:0044238	0.921	primary metabolic process
GO:0006873	0.915	intracellular monoatomic ion homeostasis
GO:0030003	0.912	intracellular monoatomic cation homeostasis
GO:0050896	0.909	response to stimulus
GO:0044237	0.907	cellular metabolic process
GO:0098771	0.889	inorganic ion homeostasis
GO:0006807	0.877	nitrogen compound metabolic process
GO:0043170	0.860	macromolecule metabolic process
GO:0006882	0.834	intracellular zinc ion homeostasis
GO:0065007	0.807	biological regulation
GO:0051716	0.795	cellular response to stimulus
GO:0050789	0.743	regulation of biological process
GO:0050794	0.719	regulation of cellular process
GO:0006725	0.717	cellular aromatic compound metabolic process
GO:0034641	0.501	cellular nitrogen compound metabolic process
GO:0055085	0.496	transmembrane transport
GO:1901360	0.484	organic cyclic compound metabolic process
GO:0006139	0.435	nucleobase-containing compound metabolic process
GO:0006950	0.430	response to stress
GO:0019222	0.430	regulation of metabolic process
GO:0048518	0.427	positive regulation of biological process
GO:0044260	0.403	cellular macromolecule metabolic process
GO:0090304	0.372	nucleic acid metabolic process
GO:0098662	0.341	inorganic cation transmembrane transport
GO:0033554	0.334	cellular response to stress
GO:0098655	0.333	monoatomic cation transmembrane transport
GO:0031323	0.319	regulation of cellular metabolic process
GO:0006289	0.306	nucleotide-excision repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.999	endomembrane system
GO:0005634	0.999	nucleus
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0031982	0.996	vesicle
GO:0031410	0.994	cytoplasmic vesicle
GO:0005783	0.990	endoplasmic reticulum
GO:0005856	0.984	cytoskeleton
GO:0016020	0.960	membrane
GO:0070013	0.487	intracellular organelle lumen
GO:0031981	0.446	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29351	0.519	Zn(2+)(in) = Zn(2+)(out)

[back to server]