StarFunc result for job id Q6PRD1

User Input

>input (2367 residues)
MGTRGAVMPPPMWGLLGCCFVCAWALGGPRPIRSLPPLSSQVKPGSVPMQVPLEGAEAAL
AYLYSGDAQQLSQVNCSERYEARGAGAMPGLPPSLQGAAGTLAQAANFLNMLLQANDIRE
SSVEEDVEWYQALVRSVAEGDPRVYRALLTFNPPPGASHLQLALQATRTGEETILQDLSG
NWVQEENPPGDLDTPALKKRVLTNDLGSLGSPKWPQADGYVGDTQQVRLSPPFLECQEGR
LRPGWLITLSATFYGLKPDLSPEVRGQVQMDVDLQSVDINQCASGPGWYSNTHLCDLNST
QCVPLESQGFVLGRYLCRCRPGFYGASPSGGLEESDFQTTGQFGFPEGRSGRLLQCLPCP
EGCTSCMDATPCLVEEAAVLRAAVLACQACCMLAIFLSMLVSYRCRRNKRIWASGVVLLE
TVLFGFLLLYFPVFILYFKPSVFRCIALRWVRLLGFAIVYGTIILKLYRVLQLFLSRTAQ
RSALLSSGRLLRRLGLLLLPVLGFLAVWTVGALERGIQHAPLVIRGHTPSGRHFYLCHHD
RWDYIMVVAELLLLCWGSFLCYATRAVLSAFHEPRYMGIALHNELLLSAAFHTARFVLVP
SLHPDWTLLLFFFHTHSTVTTTLALIFIPKFWKLGAPPREEMVDEVCEDELDLQHSGSYL
GSSIASAWSEHSLDPGDIRDELKKLYAQLEVHKTKEMAANNPHLPKKRGSSCQGLGRSFM
RYLAEFPEALARQHSRDSGSPGHGSLPGSSRRRLLSSSLQEPEGTPALHKSRSTYDQRRE
QDPPLLDSLLRRKLAKKASRTESRESVEGPPALGFRSASAHNLTVGERLPRARPASLQKS
LSVASSREKALLMASQAYLEETYRQAKEREERKKAKAAMASLVRRPSARRLERPRGAPLS
APPSPAKSSSVDSSHTSGRLHEEARRRLPHPPIRHQVSTPILALSGGLGEPRMLSPTSTL
APALLPALAPTPAPALAPVPVSPQSPNLLTYICPWENAELPAKQENVPQEGPSGPERGHH
SPAPARARLWRALSVAVEKSRAGENEMDAEDAHHQREANDVDEDRPKIFPKSHSLKAPVQ
QGSMRSLGLAIKALTRSRSTYREKESVEESPEGQNSGTAGESMGAPSRSPRLGRPKAVSK
QAALIPSDDKESLQNQQNAHTSRMLQVCQREGSREQEDRGRRMTQGLGERKAERAGKTGL
AMLRQVSRDKNIKQSKETPVGWQELPKAGLQSLGSADHRVAEVCPWEVTESETRQPDSGN
KAEICPWETSEGAPESRALRQDPGDSQKKRGEARGKSEPIDVVPMMRKKPERLVREQEAV
CPWESADRGGLSPGSAPQDPGRIRDKSEAGDSVEARKVEKPGWEAAGPEAHTPDITKAEP
CPWEASEGGEDGKPAQEAVKDLPQEKQKTRKATFWKEQKPGGDLESLCPWESTDFRGPSA
VSIQAPGSSECSGSLGSGIAEVCLWEAGDAPAIQKAEICPWELDDNVMGQEMLSLGTGRE
SLQEKEKASRKGSFGEMGEQTVKAVQKLSQQQESVCPRESTVPGHSSPCLDNSSSKAGSQ
FLCNGGSRATQVCPQEDLRPEAQEATPAKTEICPWEVNERTREEWTSAQVPRGGESQKDK
EKMPGKSEIEDVTAWEKPEGQIQKQEAVGPWESVDPGSFSPQPRPQDTERPQTLLQMSGS
VGSKAADICPLDVEENLTAGKAEICPWEVGAGAGEERALGAEAIRKSPNDTGKVSADLGP
RERAVTAPEKPQKPTPEWEVACPWGSVGPGACSQHPGTLDADGPKAGFQELDHMGCRPGE
VCPWEAQEAATSEKAKICPWEVSEGTTGKGLDQKAGSESAEQREKALEKGRLTSLGEDVS
KGMAKLCQQQETICIWENKDLRESPAQAPKISDLPSSMSSEVAEGHSLEATEKGDLRQDP
KTGSFPEHITQEKAPAADTEEFTTEDGEKTSHELQSVCPWETTAPADSVSHLDRQRPDQP
KASSQRLVSTGGRAADVCPWDVPDAGVYKSDSSAKAETCPWEVTERIPVKGVSRQDGKGD
SQEEKGRAPEKSEPKGVPVQKKPEMADFRQQEAVCPWESQDGKGLSPQPAPDASDRSRGS
SEAAGSVETRVAEVCLWEVVEAPSAKKAEICPWEAGGGAAEEGEQERESQGQGEMFLQKA
GPGGTEEHFSKAAAKPREQEAVCPGEGTGSGGLLPQSGALDPELKVSPKEAGSMGSRMAE
LCQWEITDPEGNKIKGTMADICPGEETGVPSEESGLLALTATRREFFPTAPEKPLCLLVH
GPLDHFFPESKIPCPKVSRPASTFTLEGVRELQGPSGLEPRTSLAPEPSLQEAESQSSSL
TEDSGQVAFEAQYEEFTPPTVYPWDWE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PY61	0.336	0.346	0.000	2293	0.651	0.672	E9PY61.pdb.gz	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1
2	AFDB:Q6PRD1	0.999	0.999	0.000	2367	1.000	1.000	Q6PRD1.pdb.gz	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2
3	AFDB:A0A0R4IF44	0.260	0.339	1.572E-77	1792	0.254	0.336	A0A0R4IF44.pdb.gz
4	PDB:7epcA	0.106	0.285	1.461E-8	782	0.032	0.096	7epcA.pdb.gz
5	PDB:7e9hR	0.117	0.329	1.794E-8	766	0.028	0.087	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
6	PDB:7c7sA	0.100	0.329	2.705E-8	685	0.024	0.083	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
7	PDB:7e9gR	0.107	0.301	3.497E-8	769	0.032	0.099	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
8	PDB:6w2xB	0.099	0.330	6.819E-8	669	0.023	0.082	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
9	PDB:7epaA	0.106	0.294	1.200E-7	782	0.031	0.095	7epaA.pdb.gz
10	PDB:7wihA	0.099	0.278	3.746E-6	741	0.030	0.094	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
11	AFDB:Q9VE13	0.029	0.034	1.370E-4	1788	0.111	0.147	Q9VE13.pdb.gz	Q9VE13_DROME Wiskott-Aldrich syndrome protein family member OS=Drosophila melanogaster OX=7227 GN=gukh PE=1 SV=3
12	AFDB:Q6P5H2	0.032	0.038	1.518E-4	1864	0.115	0.146	Q6P5H2.pdb.gz	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
13	AFDB:Q70IV5	0.028	0.036	3.115E-4	1561	0.086	0.130	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
14	AFDB:P48681	0.026	0.034	3.453E-4	1621	0.109	0.159	P48681.pdb.gz	NEST_HUMAN Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2
15	PDB:6ffhA	0.088	0.450	4.012E-4	414	0.025	0.140	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
16	AFDB:Q5VT52	0.042	0.058	4.028E-4	1461	0.094	0.152	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
17	AFDB:Q8CJF7	0.041	0.042	4.240E-4	2243	0.111	0.117	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
18	AFDB:Q15154	0.033	0.037	1.247E-3	2024	0.093	0.109	Q15154.pdb.gz	PCM1_HUMAN Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1 PE=1 SV=5
19	PDB:7w2zR	0.090	0.540	1.779E-3	301	0.016	0.130	7w2zR.pdb.gz	Molecular mechanism of agonism and inverse agonism in ghrelin receptor.
20	PDB:4xesA	0.082	0.306	2.076E-3	471	0.016	0.079	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PY61	0.0	2707	2293	0.655	0.676	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1
2	Q6PRD1	0.0	4798	2367	1.000	1.000	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2
3	Q8C419	0.0	748	1200	0.178	0.351	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
4	Q8BFV4	2.13e-159	497	333	0.104	0.736	Q8BFV4_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Gpr179 PE=2 SV=1
5	M9PEK9	2.91e-53	206	926	0.060	0.152	M9PEK9_DROME Smog, isoform F OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
6	M9ND25	4.40e-53	206	951	0.063	0.156	M9ND25_DROME Smog, isoform D OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
7	Q59E18	1.59e-52	204	944	0.060	0.151	Q59E18_DROME Smog, isoform C OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
8	M9NDF0	3.69e-52	202	894	0.060	0.160	M9NDF0_DROME Smog, isoform E OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
9	Q9VR40	1.18e-41	169	790	0.049	0.148	Q9VR40_DROME Smog, isoform B OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=3
10	Q9Y133	8.81e-13	76.6	1221	0.028	0.055	Q9Y133_DROME BcDNA.GH07312 OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=2 SV=1
11	Q8IN24	9.75e-13	76.6	1220	0.028	0.055	Q8IN24_DROME Metabotropic GABA-B receptor subtype 2, isoform A OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
12	Q9BML6	1.07e-12	76.6	1220	0.028	0.055	Q9BML6_DROME Metabotropic GABA-B receptor subtype 2 OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=1 SV=1
13	A0A0B4LHR4	4.46e-12	74.3	1224	0.027	0.053	A0A0B4LHR4_DROME Metabotropic GABA-B receptor subtype 2, isoform C OS=Drosophila melanogaster OX=7227 GN=GABA-B-R2 PE=4 SV=1
14	Q8IN49	7.64e-11	70.1	807	0.028	0.082	Q8IN49_DROME MIP05539p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31195 PE=1 SV=2
15	G5ECB2	1.47e-10	69.3	842	0.027	0.077	GABR2_CAEEL Gamma-aminobutyric acid type B receptor subunit 2 OS=Caenorhabditis elegans OX=6239 GN=gbb-2 PE=1 SV=1
16	Q54ET0	1.01e-09	66.6	816	0.025	0.072	GRLE_DICDI Metabotropic glutamate receptor-like protein E OS=Dictyostelium discoideum OX=44689 GN=grlE PE=2 SV=2
17	O75899	1.10e-08	63.2	941	0.025	0.063	GABR2_HUMAN Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens OX=9606 GN=GABBR2 PE=1 SV=1
18	Q80T41	2.45e-08	62.0	940	0.025	0.063	GABR2_MOUSE Gamma-aminobutyric acid type B receptor subunit 2 OS=Mus musculus OX=10090 GN=Gabbr2 PE=1 SV=2
19	O88871	2.52e-08	62.0	940	0.025	0.063	GABR2_RAT Gamma-aminobutyric acid type B receptor subunit 2 OS=Rattus norvegicus OX=10116 GN=Gabbr2 PE=1 SV=2
20	P91685	3.67e-08	61.6	976	0.029	0.071	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	7.8e-38	142.3	7 transmembrane sweet-taste receptor of 3 GCPR
2	PF10470 AKAP7_RIRII_bdg	4.8e+02	12.2	PKA-RI-RII subunit binding domain of A-kinase anchor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483469

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380876	0.861	Regulator of G-protein signaling 11
2	9606.ENSP00000355523	0.849	Regulator of G-protein signaling 7
3	9606.ENSP00000469759	0.847	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3
4	9606.ENSP00000437849	0.828	Transient receptor potential cation channel subfamily M member 1
5	9606.ENSP00000340328	0.820	Nyctalopin
6	9606.ENSP00000231188	0.816	Metabotropic glutamate receptor 6
7	9606.ENSP00000346964	0.791	Pikachurin
8	9606.ENSP00000456548	0.734	Protein ELFN1
9	9606.ENSP00000261837	0.712	Guanine nucleotide-binding protein subunit beta-5
10	9606.ENSP00000365441	0.695	Voltage-dependent L-type calcium channel subunit alpha-1F
11	9606.ENSP00000324960	0.692	Calcium-binding protein 4
12	9606.ENSP00000262494	0.656	Guanine nucleotide-binding protein G(o) subunit alpha
13	9606.ENSP00000309493	0.637	G-protein coupled receptor family C group 6 member A
14	9606.ENSP00000334134	0.601	Regulator of G-protein signaling 9-binding protein
15	9606.ENSP00000261892	0.580	Sodium/potassium/calcium exchanger 1
16	9606.ENSP00000372169	0.577	Voltage-dependent calcium channel subunit alpha-2/delta-4
17	9606.ENSP00000420295	0.547	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit beta
18	9606.ENSP00000232461	0.541	Guanine nucleotide-binding protein G(t) subunit alpha-1
19	9606.ENSP00000334851	0.540	Regulator of G-protein signaling 7-binding protein
20	9606.ENSP00000318480	0.535	ATP-dependent zinc metalloprotease YME1L1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007601	0.994	visual perception
GO:0009987	0.908	cellular process
GO:0050789	0.500	regulation of biological process
GO:0050794	0.398	regulation of cellular process
GO:0051179	0.324	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043005	0.997	neuron projection
GO:0044292	0.992	dendrite terminus
GO:0005886	0.978	plasma membrane
GO:0005622	0.688	intracellular anatomical structure
GO:0043226	0.433	organelle
GO:0032991	0.353	protein-containing complex
GO:0005737	0.332	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]