StarFunc result for job id Q6PXP3

User Input

>input (512 residues)
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDGKLMLLLWSCTVSMFPLGGLLGSLLVGLLVDSCGRKGTLLINNIFAIIPAI
LMGVSKVAKAFELIVFSRVVLGVCAGISYSALPMYLGELAPKNLRGMVGTMTEVFVIVGV
FLAQIFSLQAILGNPAGWPVLLALTGVPALLQLLTLPFFPESPRYSLIQKGDEATARQAL
RRLRGHTDMEAELEDMRAEARAERAEGHLSVLHLCALRSLRWQLLSIIVLMAGQQLSGIN
AINYYADTIYTSAGVEAAHSQYVTVGSGVVNIVMTITSAVLVERLGRRHLLLAGYGICGS
ACLVLTVVLLFQNRVPELSYLGIICVFAYIAGHSIGPSPVPSVVRTEIFLQSSRRAAFMV
DGAVHWLTNFIIGFLFPSIQEAIGAYSFIIFAGICLLTAIYIYVVIPETKGKTFVEINRI
FAKRNRVKLPEEKEETIDAGPPTASPAKETSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6PXP3	1.000	1.000	5.518E-66	512	1.000	1.000	Q6PXP3.pdb.gz	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
2	AFDB:P43427	0.925	0.943	1.670E-46	502	0.557	0.568	P43427.pdb.gz	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
3	AFDB:Q9WV38	0.937	0.958	2.124E-46	501	0.553	0.565	Q9WV38.pdb.gz	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
4	AFDB:P22732	0.924	0.944	9.374E-46	501	0.574	0.587	P22732.pdb.gz	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
5	PDB:4ybqB	0.848	0.938	1.052E-37	462	0.535	0.593	4ybqB.pdb.gz
6	AFDB:P11166	0.912	0.948	4.219E-36	492	0.371	0.386	P11166.pdb.gz	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
7	AFDB:Q3T9X0	0.836	0.799	4.572E-36	538	0.426	0.405	Q3T9X0.pdb.gz	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
8	AFDB:Q285P3	0.906	0.951	4.954E-36	488	0.363	0.381	Q285P3.pdb.gz	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
9	AFDB:F1R0Q1	0.900	0.942	6.054E-36	489	0.365	0.382	F1R0Q1.pdb.gz	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
10	AFDB:P14142	0.897	0.902	8.017E-36	509	0.383	0.385	P14142.pdb.gz	GLUT4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus OX=10090 GN=Slc2a4 PE=1 SV=3
11	AFDB:P46896	0.906	0.946	1.105E-35	490	0.375	0.392	P46896.pdb.gz	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
12	PDB:7sptA	0.897	0.976	1.924E-32	470	0.359	0.391	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.
13	PDB:6thaA	0.771	0.872	1.180E-29	448	0.348	0.397	6thaA.pdb.gz
14	PDB:7wsmA	0.792	0.867	4.619E-29	464	0.369	0.407	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
15	PDB:4gbyA	0.779	0.836	1.675E-18	475	0.213	0.229	4gbyA.pdb.gz	Crystal structure of a bacterial homologue of glucose transporters GLUT1-4.
16	PDB:7aaqA	0.811	0.851	2.821E-18	487	0.219	0.230	7aaqA.pdb.gz	Molecular mechanism of sugar transport in plants unveiled by structures of glucose/H + symporter STP10.
17	PDB:4ja4A	0.649	0.738	1.549E-13	442	0.203	0.235	4ja4A.pdb.gz
18	PDB:7zh0A	0.571	0.589	4.657E-9	495	0.154	0.160	7zh0A.pdb.gz
19	PDB:3o7qA	0.581	0.699	8.369E-8	414	0.137	0.169	3o7qA.pdb.gz
20	PDB:5oxpA	0.529	0.575	1.468E-7	462	0.129	0.143	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P22732	0.0	539	501	0.574	0.587	GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens OX=9606 GN=SLC2A5 PE=1 SV=1
2	P43427	0.0	599	502	0.553	0.564	GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus OX=10116 GN=Slc2a5 PE=1 SV=1
3	Q6PXP3	0.0	1037	512	1.000	1.000	GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens OX=9606 GN=SLC2A7 PE=1 SV=2
4	Q9WV38	0.0	580	501	0.541	0.553	GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus OX=10090 GN=Slc2a5 PE=1 SV=2
5	Q3T9X0	1.80e-148	437	538	0.422	0.401	GTR9_MOUSE Solute carrier family 2, facilitated glucose transporter member 9 OS=Mus musculus OX=10090 GN=Slc2a9 PE=1 SV=1
6	Q9NRM0	8.11e-147	433	540	0.416	0.394	GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens OX=9606 GN=SLC2A9 PE=1 SV=2
7	F1R0Q1	4.94e-128	384	489	0.393	0.411	F1R0Q1_DANRE Solute carrier family 2 member 1b OS=Danio rerio OX=7955 GN=slc2a1b PE=3 SV=2
8	P46896	9.06e-128	383	490	0.381	0.398	GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus OX=9031 GN=SLC2A1 PE=1 SV=1
9	P27674	9.34e-128	383	492	0.383	0.398	GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus OX=9913 GN=SLC2A1 PE=1 SV=1
10	P17809	9.27e-127	380	492	0.381	0.396	GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus OX=10090 GN=Slc2a1 PE=1 SV=4
11	P11166	9.89e-127	380	492	0.377	0.392	GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens OX=9606 GN=SLC2A1 PE=1 SV=2
12	Q285P3	1.30e-126	380	488	0.367	0.385	Q285P3_DANRE Facilitated glucose transporter 1 OS=Danio rerio OX=7955 GN=glut1 PE=1 SV=1
13	P11167	4.22e-126	379	492	0.379	0.394	GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus OX=10116 GN=Slc2a1 PE=1 SV=1
14	A0A060VUB5	2.51e-125	376	480	0.371	0.396	A0A060VUB5_ONCMY Major facilitator superfamily (MFS) profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00081471001 PE=3 SV=1
15	Q9I8M1	3.06e-123	371	492	0.369	0.384	Q9I8M1_ONCMY Glucose transporter 1A OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
16	P11169	9.08e-122	368	496	0.377	0.389	GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens OX=9606 GN=SLC2A3 PE=1 SV=1
17	Q9BYW1	4.59e-120	363	496	0.391	0.403	GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens OX=9606 GN=SLC2A11 PE=2 SV=1
18	P32037	2.51e-118	359	493	0.373	0.387	GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus OX=10090 GN=Slc2a3 PE=1 SV=1
19	Q07647	1.40e-117	357	493	0.363	0.377	GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus OX=10116 GN=Slc2a3 PE=1 SV=1
20	F1NTJ1	6.31e-117	355	496	0.365	0.377	F1NTJ1_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus OX=9031 GN=SLC2A14 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03620 IBV_3C	5.1e+02	12.6	IBV 3C protein
2	PF07690 MFS_1	2.3e-17	74.6	Major Facilitator Superfamily
3	PF06271 RDD	9.8	17.9	RDD family
4	PF00083 Sugar_tr	1.3e-116	401.8	Sugar (and other) transporter
5	PF20303 YLATT	5.5e+02	11.7	YEATS-Like-Associating Three TM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000383698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.647	Ras-related protein Rab-28
2	9606.ENSP00000289877	0.563	Proton-associated sugar transporter A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005353	0.999	fructose transmembrane transporter activity
GO:0055056	0.998	D-glucose transmembrane transporter activity
GO:0005488	0.826	binding
GO:0005515	0.757	protein binding
GO:0022804	0.717	active transmembrane transporter activity
GO:0015291	0.593	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015749	0.997	monosaccharide transmembrane transport
GO:0008645	0.993	hexose transmembrane transport
GO:1904659	0.976	glucose transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.781	intracellular anatomical structure
GO:0043226	0.685	organelle
GO:0005737	0.431	cytoplasm
GO:0043229	0.426	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]