StarFunc result for job id Q6Q0C0

User Input

>input (670 residues)
MSSGKSARYNRFSGGPSNLPTPDVTTGTRMETTFGPAFSAVTTITKADGTSTYKQHCRTP
SSSSTLAYSPRDEEDSMPPISTPRRSDSAISVRSLHSESSMSLRSTFSLPEEEEEPEPLV
FAEQPSVKLCCQLCCSVFKDPVITTCGHTFCRRCALKSEKCPVDNVKLTVVVNNIAVAEQ
IGELFIHCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCPNNPSCP
PLLRMNLEAHLKECEHIKCPHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHE
MHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASM
LNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTI
KVWDTCTTYKCQKTLEGHDGIVLALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIRAHDN
PVCTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAAQSYLYSGSYQT
IKIWDIRTLDCIHVLQTSGGSVYSIAVTNHHIVCGTYENLIHVWDIESKEQVRTLTGHVG
TVYALAVISTPDQTKVFSASYDRSLRVWSMDNMICTQTLLRHQGSVTALAVSRGRLFSGA
VDSTVKVWTC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Q0C0	1.000	1.000	0.000	670	1.000	1.000	Q6Q0C0.pdb.gz	TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens OX=9606 GN=TRAF7 PE=1 SV=1
2	AFDB:A0A2R8RWN9	0.395	0.492	8.883E-22	534	0.119	0.150	A0A2R8RWN9.pdb.gz	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
3	AFDB:Q8VBV4	0.361	0.343	1.311E-21	710	0.203	0.192	Q8VBV4.pdb.gz	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
4	PDB:5mzhB	0.366	0.568	3.165E-21	415	0.121	0.195	5mzhB.pdb.gz
5	PDB:6ttuT	0.390	0.651	3.662E-21	394	0.124	0.211	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
6	AFDB:B8A474	0.359	0.320	5.368E-21	760	0.216	0.191	B8A474.pdb.gz
7	AFDB:Q9UTC7	0.406	0.581	1.464E-19	462	0.097	0.141	Q9UTC7.pdb.gz	YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.12 PE=4 SV=1
8	AFDB:Q57X86	0.399	0.384	2.624E-19	698	0.097	0.093	Q57X86.pdb.gz	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
9	PDB:7bt6x	0.344	0.458	7.332E-19	488	0.122	0.168	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
10	AFDB:Q5XUX1	0.391	0.563	1.075E-18	458	0.104	0.153	Q5XUX1.pdb.gz	FBXW9_HUMAN F-box/WD repeat-containing protein 9 OS=Homo sapiens OX=9606 GN=FBXW9 PE=1 SV=3
11	AFDB:Q8RXA7	0.394	0.226	1.244E-18	1187	0.103	0.058	Q8RXA7.pdb.gz	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
12	PDB:5jcsq	0.354	0.472	3.648E-18	488	0.115	0.158	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
13	PDB:1vyhC	0.395	0.836	4.020E-18	310	0.134	0.290	1vyhC.pdb.gz
14	AFDB:Q54R82	0.396	0.284	4.403E-18	942	0.094	0.067	Q54R82.pdb.gz	MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum OX=44689 GN=mkkA PE=1 SV=2
15	AFDB:P07834	0.345	0.300	4.852E-18	779	0.204	0.176	P07834.pdb.gz	CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC4 PE=1 SV=2
16	PDB:5nnzA	0.358	0.673	4.883E-18	335	0.109	0.218	5nnzA.pdb.gz
17	PDB:2h9lA	0.403	0.809	5.126E-18	321	0.119	0.249	2h9lA.pdb.gz
18	PDB:5yzgs	0.400	0.700	8.751E-18	374	0.101	0.182	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
19	PDB:3jcmB	0.398	0.611	1.356E-17	429	0.099	0.154	3jcmB.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
20	PDB:5mqfF	0.388	0.813	1.905E-17	307	0.106	0.231	5mqfF.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZSA7	0.0	1121	638	0.803	0.843	A0A8I5ZSA7_RAT TNF receptor associated factor 7 OS=Rattus norvegicus OX=10116 GN=Traf7 PE=4 SV=1
2	A0A8I5ZTK4	0.0	1248	629	0.910	0.970	A0A8I5ZTK4_RAT TNF receptor associated factor 7 OS=Rattus norvegicus OX=10116 GN=Traf7 PE=4 SV=1
3	A0A8I6A9T1	0.0	1267	670	0.925	0.925	A0A8I6A9T1_RAT TNF receptor associated factor 7 OS=Rattus norvegicus OX=10116 GN=Traf7 PE=4 SV=1
4	A0A8I6AMJ5	0.0	1196	628	0.861	0.919	A0A8I6AMJ5_RAT TNF receptor associated factor 7 OS=Rattus norvegicus OX=10116 GN=Traf7 PE=4 SV=1
5	B1WBW7	0.0	1358	669	0.970	0.972	B1WBW7_RAT Traf7 protein OS=Rattus norvegicus OX=10116 GN=Traf7 PE=1 SV=1
6	F7FIY6	0.0	1285	664	0.948	0.956	F7FIY6_RAT TNF receptor associated factor 7 OS=Rattus norvegicus OX=10116 GN=Traf7 PE=1 SV=1
7	Q6Q0C0	0.0	1396	670	1.000	1.000	TRAF7_HUMAN E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens OX=9606 GN=TRAF7 PE=1 SV=1
8	Q922B6	0.0	1224	594	0.872	0.983	TRAF7_MOUSE E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus OX=10090 GN=Traf7 PE=1 SV=1
9	P90648	7.83e-39	155	732	0.142	0.130	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
10	Q8VBV4	4.43e-30	128	710	0.136	0.128	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
11	Q969H0	7.23e-30	127	707	0.136	0.129	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
12	P87053	9.29e-30	127	605	0.131	0.145	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
13	B7ZDC8	1.03e-29	126	544	0.130	0.160	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
14	Q9VZF4	4.88e-29	126	1326	0.125	0.063	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
15	O44382	5.10e-29	123	510	0.131	0.173	O44382_DROME Slimb OS=Drosophila melanogaster OX=7227 GN=slmb PE=2 SV=1
16	Q9VDE3	1.11e-28	122	510	0.130	0.171	Q9VDE3_DROME LD08669p OS=Drosophila melanogaster OX=7227 GN=slmb PE=1 SV=1
17	Q5SRY7	1.28e-28	122	542	0.119	0.148	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
18	A0A0B4KHK1	1.31e-28	123	597	0.130	0.146	A0A0B4KHK1_DROME Supernumerary limbs, isoform B OS=Drosophila melanogaster OX=7227 GN=slmb PE=4 SV=1
19	Q9UKB1	1.95e-28	122	542	0.119	0.148	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
20	Q91854	9.34e-28	120	518	0.116	0.151	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07798 CCDC90-like	4.9e+02	12.1	Coiled-coil domain-containing protein 90-like
2	PF19220 Crescentin	5.1e+02	11.1	Crescentin protein
3	PF01519 DUF16	3.7e+02	13.0	Protein of unknown function DUF16
4	PF07889 DUF1664	4.2e+02	12.4	Protein of unknown function (DUF1664)
5	PF13747 DUF4164	18	17.0	Domain of unknown function (DUF4164)
6	PF00038 Filament	1.4e+02	13.4	Intermediate filament protein
7	PF09486 HrpB7	4e+02	12.8	Bacterial type III secretion protein (HrpB7)
8	PF20426 NBCH_WD40	7.8e-07	39.8	Neurobeachin beta propeller domain
9	PF11715 Nup160	3.7	17.8	Nucleoporin Nup120/160
10	PF16808 PKcGMP_CC	0.2	22.7	Coiled-coil N-terminus of cGMP-dependent protein kinase
11	PF03145 Sina	0.44	22.0	Seven in absentia protein family
12	PF12718 Tropomyosin_1	99	14.5	Tropomyosin like
13	PF00400 WD40	5.6e-28	107.8	WD domain, G-beta repeat
14	PF17005 WD40_like	0.0023	28.9	WD40-like domain
15	PF00097 zf-C3HC4	0.098	23.9	Zinc finger, C3HC4 type (RING finger)
16	PF13923 zf-C3HC4_2	0.1	23.7	Zinc finger, C3HC4 type (RING finger)
17	PF13920 zf-C3HC4_3	2.6	19.3	Zinc finger, C3HC4 type (RING finger)
18	PF15227 zf-C3HC4_4	0.86	21.1	zinc finger of C3HC4-type, RING
19	PF14634 zf-RING_5	41	15.6	zinc-RING finger domain
20	PF13445 zf-RING_UBOX	0.0081	27.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354927	0.838	Mitogen-activated protein kinase kinase kinase 3
2	9606.ENSP00000483825	0.791	NF-kappa-B essential modulator
3	9606.ENSP00000341268	0.746	Tumor necrosis factor receptor type 1-associated DEATH domain protein
4	9606.ENSP00000379931	0.734	Ubiquitin-conjugating enzyme E2 E2
5	9606.ENSP00000362994	0.656	TNF receptor-associated factor 1
6	9606.ENSP00000344666	0.653	Merlin
7	9606.ENSP00000264254	0.650	Phosducin-like protein 3
8	9606.ENSP00000379975	0.644	Integrin-linked protein kinase
9	9606.ENSP00000358335	0.605	Mitogen-activated protein kinase kinase kinase 7
10	9606.ENSP00000392025	0.602	Ubiquitin carboxyl-terminal hydrolase CYLD
11	9606.ENSP00000388107	0.601	Ubiquitin-60S ribosomal protein L40
12	9606.ENSP00000361359	0.589	Tumor necrosis factor receptor superfamily member 5
13	9606.ENSP00000373696	0.567	E3 ubiquitin-protein ligase TRIP12
14	9606.ENSP00000363804	0.535	Krueppel-like factor 4
15	9606.ENSP00000338413	0.519	Ubiquitin-like modifier-activating enzyme 1
16	9606.ENSP00000433623	0.517	TNF receptor-associated factor 6
17	9606.ENSP00000162749	0.513	Tumor necrosis factor receptor superfamily member 1A
18	9606.ENSP00000451828	0.512	RAC-alpha serine/threonine-protein kinase
19	9606.ENSP00000384109	0.504	Cullin-4B
20	9606.ENSP00000370718	0.503	N-acetylserotonin O-methyltransferase-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.996	catalytic activity, acting on a protein
GO:0004842	0.990	ubiquitin-protein transferase activity
GO:0042802	0.388	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.998	positive regulation of cellular process
GO:0010941	0.985	regulation of cell death
GO:0010942	0.975	positive regulation of cell death
GO:0043067	0.935	regulation of programmed cell death
GO:0043065	0.932	positive regulation of apoptotic process
GO:1901214	0.820	regulation of neuron death
GO:0043525	0.796	positive regulation of neuron apoptotic process
GO:0009987	0.635	cellular process
GO:0019222	0.555	regulation of metabolic process
GO:0071704	0.535	organic substance metabolic process
GO:0044238	0.531	primary metabolic process
GO:0043170	0.524	macromolecule metabolic process
GO:0006807	0.523	nitrogen compound metabolic process
GO:0080090	0.462	regulation of primary metabolic process
GO:0051171	0.441	regulation of nitrogen compound metabolic process
GO:0060255	0.438	regulation of macromolecule metabolic process
GO:0050896	0.401	response to stimulus
GO:0019538	0.368	protein metabolic process
GO:0031323	0.347	regulation of cellular metabolic process
GO:0051716	0.335	cellular response to stimulus
GO:0009893	0.330	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0005829	0.988	cytosol
GO:0005634	0.987	nucleus
GO:0032991	0.982	protein-containing complex
GO:0016020	0.954	membrane
GO:0005886	0.941	plasma membrane
GO:1902494	0.873	catalytic complex
GO:1990234	0.726	transferase complex
GO:0140535	0.705	intracellular protein-containing complex
GO:0000151	0.411	ubiquitin ligase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.994	Transferases.

[back to server]