StarFunc result for job id Q6Q4G3

User Input

>input (990 residues)
MGPPSSSGFYVSRAVALLLAGLVAALLLALAVLAALYGHCERVPPSELPGLRDLEAESSP
PLRQKPTPTPKPSSARELAVTTTPSNWRPPGPWDQLRLPPWLVPLHYDLELWPQLRPDEL
PAGSLPFTGRVNITVRCTVATSRLLLHSLFQDCERAEVRGPLSPGTGNATVGRVPVDDVW
FALDTEYMVLELSEPLKPGSSYELQLSFSGLVKEDLREGLFLNVYTDQGERRALLASQLE
PTFARYVFPCFDEPALKATFNITMIHHPSYVALSNMPKLGQSEKEDVNGSKWTVTTFSTT
PHMPTYLVAFVICDYDHVNRTERGKEIRIWARKDAIANGSADFALNITGPIFSFLEDLFN
ISYSLPKTDIIALPSFDNHAMENWGLMIFDESGLLLEPKDQLTEKKTLISYVVSHEIGHQ
WFGNLVTMNWWNNIWLNEGFASYFEFEVINYFNPKLPRNEIFFSNILHNILREDHALVTR
AVAMKVENFKTSEIQELFDIFTYSKGASMARMLSCFLNEHLFVSALKSYLKTFSYSNAEQ
DDLWRHFQMAIDDQSTVILPATIKNIMDSWTHQSGFPVITLNVSTGVMKQEPFYLENIKN
RTLLTSNDTWIVPILWIKNGTTQPLVWLDQSSKVFPEMQVSDSDHDWVILNLNMTGYYRV
NYDKLGWKKLNQQLEKDPKAIPVIHRLQLIDDAFSLSKNNYIEIETALELTKYLAEEDEI
IVWHTVLVNLVTRDLVSEVNIYDIYSLLKRYLLKRLNLIWNIYSTIIRENVLALQDDYLA
LISLEKLFVTACWLGLEDCLQLSKELFAKWVDHPENEIPYPIKDVVLCYGIALGSDKEWD
ILLNTYTNTTNKEEKIQLAYAMSCSKDPWILNRYMEYAISTSPFTSNETNIIEVVASSEV
GRYVAKDFLVNNWQAVSKRYGTQSLINLIYTIGRTVTTDLQIVELQQFFSNMLEEHQRIR
VHANLQTIKNENLKNKKLSARIAAWLRRNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Q4G3	1.000	1.000	0.000	990	1.000	1.000	Q6Q4G3.pdb.gz	AMPQ_HUMAN Aminopeptidase Q OS=Homo sapiens OX=9606 GN=LVRN PE=1 SV=4
2	AFDB:P15541	0.780	0.797	4.647E-76	966	0.355	0.363	P15541.pdb.gz	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
3	AFDB:Q59E93	0.789	0.799	8.819E-76	977	0.343	0.348	Q59E93.pdb.gz	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
4	AFDB:P15684	0.779	0.798	1.194E-74	965	0.338	0.347	P15684.pdb.gz	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
5	AFDB:P97449	0.780	0.798	6.314E-74	966	0.343	0.352	P97449.pdb.gz	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
6	PDB:5lhdC	0.802	0.873	1.863E-70	905	0.326	0.357	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
7	AFDB:Q10836	0.762	0.738	2.514E-69	1025	0.315	0.304	Q10836.pdb.gz	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
8	AFDB:B0BCY7	0.748	0.772	2.061E-65	957	0.281	0.290	B0BCY7.pdb.gz	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
9	AFDB:Q9VFX0	0.736	0.733	8.437E-65	994	0.304	0.303	Q9VFX0.pdb.gz	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
10	AFDB:P50123	0.735	0.768	1.138E-64	945	0.287	0.301	P50123.pdb.gz	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
11	AFDB:P16406	0.750	0.783	3.605E-64	945	0.279	0.292	P16406.pdb.gz	AMPE_MOUSE Glutamyl aminopeptidase OS=Mus musculus OX=10090 GN=Enpep PE=1 SV=1
12	PDB:4kx7A	0.742	0.833	1.769E-61	875	0.268	0.303	4kx7A.pdb.gz	Structural insights into central hypertension regulation by human aminopeptidase a.
13	PDB:6rqxA	0.732	0.832	6.371E-61	862	0.274	0.314	6rqxA.pdb.gz	Mechanism for antigenic peptide selection by endoplasmic reticulum aminopeptidase 1.
14	PDB:4wz9B	0.785	0.871	2.742E-58	887	0.257	0.286	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.
15	PDB:7nupD	0.732	0.812	8.325E-58	884	0.274	0.307	7nupD.pdb.gz	Endoplasmic reticulum aminopeptidase 2 complexed with a mixed hydroxamic and sulfonyl ligand
16	PDB:7pfsA	0.738	0.793	5.224E-57	916	0.274	0.296	7pfsA.pdb.gz	Inhibitor-Dependent Usage of the S1' Specificity Pocket of ER Aminopeptidase 2.
17	PDB:3mdjC	0.742	0.887	6.800E-55	819	0.263	0.317	3mdjC.pdb.gz	Structural basis for antigenic peptide precursor processing by the endoplasmic reticulum aminopeptidase ERAP1.
18	PDB:5k1vB	0.706	0.814	1.352E-53	849	0.275	0.320	5k1vB.pdb.gz	Crystal Structures of ERAP2 Complexed with Inhibitors Reveal Pharmacophore Requirements for Optimizing Inhibitor Potency.
19	PDB:4xo4A	0.543	0.609	7.793E-30	870	0.159	0.180	4xo4A.pdb.gz	Crystal Structure of E. coli Aminopeptidase N in complex with L-Methionine
20	PDB:3b7rL	0.421	0.649	2.230E-22	610	0.126	0.205	3b7rL.pdb.gz	Structure-based dissection of the active site chemistry of leukotriene a4 hydrolase: implications for m1 aminopeptidases and inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P15144	0.0	566	967	0.351	0.359	AMPN_HUMAN Aminopeptidase N OS=Homo sapiens OX=9606 GN=ANPEP PE=1 SV=4
2	P15541	0.0	605	966	0.353	0.361	AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus OX=9986 GN=ANPEP PE=1 SV=4
3	P15684	0.0	573	965	0.345	0.354	AMPN_RAT Aminopeptidase N OS=Rattus norvegicus OX=10116 GN=Anpep PE=1 SV=2
4	P97449	0.0	567	966	0.346	0.355	AMPN_MOUSE Aminopeptidase N OS=Mus musculus OX=10090 GN=Anpep PE=1 SV=4
5	Q0P5U8	0.0	2006	979	0.987	0.998	Q0P5U8_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=FLJ90650 PE=1 SV=1
6	Q59E93	0.0	565	977	0.351	0.355	Q59E93_HUMAN Aminopeptidase (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
7	Q6Q4G3	0.0	2043	990	1.000	1.000	AMPQ_HUMAN Aminopeptidase Q OS=Homo sapiens OX=9606 GN=LVRN PE=1 SV=4
8	Q10836	2.00e-147	466	1025	0.319	0.308	TRHDE_RAT Thyrotropin-releasing hormone-degrading ectoenzyme OS=Rattus norvegicus OX=10116 GN=Trhde PE=1 SV=1
9	Q7KRW4	3.62e-147	465	999	0.304	0.301	Q7KRW4_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=superdeath PE=1 SV=1
10	Q9UKU6	3.12e-143	455	1024	0.290	0.280	TRHDE_HUMAN Thyrotropin-releasing hormone-degrading ectoenzyme OS=Homo sapiens OX=9606 GN=TRHDE PE=2 SV=1
11	Q9VFX0	1.29e-137	440	994	0.316	0.315	Q9VFX0_DROME Aminopeptidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8773 PE=1 SV=2
12	P50123	3.51e-132	424	945	0.308	0.323	AMPE_RAT Glutamyl aminopeptidase OS=Rattus norvegicus OX=10116 GN=Enpep PE=1 SV=2
13	B0BCY9	5.22e-131	421	957	0.289	0.299	B0BCY9_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
14	Q9JJ22	9.08e-128	412	930	0.293	0.312	ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus OX=10116 GN=Erap1 PE=2 SV=2
15	B0BCZ2	5.05e-127	410	957	0.291	0.301	B0BCZ2_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
16	B0BCZ5	5.43e-127	410	957	0.291	0.301	B0BCZ5_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
17	B0BCZ1	1.14e-126	410	957	0.291	0.301	B0BCZ1_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
18	B0BCY8	2.08e-126	409	957	0.290	0.300	B0BCY8_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
19	B0BCY7	2.72e-126	409	957	0.290	0.300	B0BCY7_HUMAN Aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=2 SV=1
20	Q07075	3.25e-126	409	957	0.290	0.300	AMPE_HUMAN Glutamyl aminopeptidase OS=Homo sapiens OX=9606 GN=ENPEP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11838 ERAP1_C	7.1e-57	204.9	ERAP1-like C-terminal domain
2	PF01433 Peptidase_M1	4.6e-61	217.7	Peptidase family M1 domain
3	PF17900 Peptidase_M1_N	1.2e-38	144.7	Peptidase M1 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350541

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263671	0.767	Chordin-related protein 2 variant III
2	9606.ENSP00000274368	0.682	Corticotropin-releasing factor-binding protein
3	9606.ENSP00000349658	0.664	X-prolyl aminopeptidase 3
4	9606.ENSP00000360147	0.664	Xaa-Pro aminopeptidase 2
5	9606.ENSP00000421566	0.664	Xaa-Pro aminopeptidase 1
6	9606.ENSP00000226299	0.659	Cytosol aminopeptidase
7	9606.ENSP00000418525	0.645	Neprilysin
8	9606.ENSP00000348395	0.630	Probable aminopeptidase NPEPL1
9	9606.ENSP00000290866	0.628	Angiotensin-converting enzyme
10	9606.ENSP00000264029	0.621	Trehalase
11	9606.ENSP00000353731	0.621	Dipeptidyl peptidase 4
12	9606.ENSP00000365686	0.586	Solute carrier family 15 member 1
13	9606.ENSP00000389326	0.566	Angiotensin-converting enzyme 2
14	9606.ENSP00000365233	0.558	Tripeptidyl-peptidase 2
15	9606.ENSP00000358106	0.548	Prolyl endopeptidase
16	9606.ENSP00000354850	0.536	Protein O-GlcNAcase
17	9606.ENSP00000364464	0.535	Aminopeptidase O
18	9606.ENSP00000353375	0.525	Microtubule-associated protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008233	0.999	peptidase activity
GO:0004177	0.975	aminopeptidase activity
GO:0008235	0.637	metalloexopeptidase activity
GO:0043167	0.589	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.928	organic substance metabolic process
GO:0009987	0.903	cellular process
GO:0044238	0.901	primary metabolic process
GO:0006807	0.888	nitrogen compound metabolic process
GO:1901564	0.865	organonitrogen compound metabolic process
GO:0043170	0.773	macromolecule metabolic process
GO:0019538	0.634	protein metabolic process
GO:0065007	0.502	biological regulation
GO:0006508	0.430	proteolysis
GO:0032501	0.421	multicellular organismal process
GO:0050789	0.336	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0071944	0.978	cell periphery
GO:0012505	0.938	endomembrane system
GO:0005886	0.929	plasma membrane
GO:0031090	0.843	organelle membrane
GO:0005576	0.804	extracellular region
GO:0005615	0.764	extracellular space
GO:0005764	0.605	lysosome
GO:0098588	0.579	bounding membrane of organelle
GO:0031982	0.563	vesicle
GO:0031974	0.397	membrane-enclosed lumen
GO:0070013	0.375	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	0.999	Acting on peptide bonds (peptidases).
EC:3.4.11.-	0.975	Aminopeptidases.

[back to server]