StarFunc result for job id Q6Q759

User Input

>input (2223 residues)
MAPKKEKGGTVNTSSKIWEPSLIAAQFNQNDWQASIAFVVGNQIEDDLLIQALTVAVQVP
QRKLFSMVSWQDILQQINEINTLVGSASSKKAKKPVGGNAPLYYEVLTAAKAIMDSGEKL
TLPLIGKLLKFQLLQIKFKDQQRRENEKKVIEDKPKLEKDKGKAKSPKEKKAPSAKPAKG
KGKDQPEANAPVKKTTQLKRRGEDDHTNRYIDDEPDDGAQHYIIVVGFNNPQLLAIMAEL
GIPITSVIKISSENYEPLQTHLAAVNQQQEVLLQSEDLEAEKLKKENAIKELKTFWKYLE
PVLNNEKPETNLFDVARLEYMVKAADFPSDWSDGEMMLKLGTDIFENIACLMYDILDWKR
QHQHYLESMQLINVPQVVNEKPVLEAMPTSEAPQPAVPAPGKKKAQYEEPQAPPPVTSVI
TTEVDMRYYNYLLNPIREEFISVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRI
AAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAVPKGPLLLNYHDAHAHKKYALQDQK
NFDPVQIEQEMQSKLPLWEFLQFPLPPPWNNTKRLATIHELMHFCTSDVLSWNEVERAFK
VFTFESLKLSEVDEKGKLKPSGMMCGSDSEMFNIPWDNPARFAKQIRQQYVMKMNTQEAK
QKADIKIKDRTLFVDQNLSMSVQDNESNREPSDPSQCDANNMKHSDLNNLKLSVPDNRQL
LEQESIMKAQPQHESLEQTTNNEIKDDAVTKADSHEKKPKKMMVEADLEDIKKTQQRSLM
DWSFTEHFKPKVLLQVLQEAHKQYRCVDSYYHTQDNSLLLVFHNPMNRQRLHCEYWNIAL
HSNVGFRNYLELVAKSIQDWITKEEAIYQESKMNEKIIRTRAELELKSSANAKLTSASKI
FSIKESKSNKGISKTEISDQEKEKEKEKIPFILEGSLKAWKEEQHRLAEEERLREEKKAE
KKGKEAGKKKGKDNAEKEDSRSLKKKSPYKEKSKEEQVKIQEVTEESPHQPEPKITYPFH
GYNMGNIPTQISGSNYYLYPSDGGQIEVEKTMFEKGPTFIKVRVVKDNHNFMIHLNDPKE
IVKKEEKGDYYLEEEEEGDEEQSLETEVSDAKNKAFSKFGSFSATLENGICLSISYYGSN
GMAPEDKDPDLETILNIPSALTPTVVPVIVTVPQSKAKGKIKGKEKPKESLKEEEHPKEE
EKKEEEVEPEPVLQETLDVPTFQSLNVSCPSGLLLTFIGQESTGQYVIDEEPTWDIMVRQ
SYPQRVKHYEFYKTVMPPAEQEASRVITSQGTVVKYMLDGSTQILFADGAVSRSPNSGLI
CPPSEMPATPHSGDLMDSISQQKSETIPSEITNTKKGKSHKSQSSMAHKGEIHDPPPEAV
QTVTPVEVHIGTWFTTTPEGNRIGTKGLERIADLTPLLSFQATDPVNGTVMTTREDKVVI
VERKDGTRIVDHADGTRITTFYQVYEDQIILPDDQETTEGPRTVTRQVKCMRVESSRYAT
VIANCEDSSCCATFGDGTTIIAKPQGTYQVLPPNTGSLYIDKDCSAVYCHESSSNIYYPF
QKREQLRAGRYIMRHTSEVICEVLDPEGNTFQVMADGSISTILPEKKLEDDLNEKTEGYD
SLSSMHLEKNHQQIYGEHVPRFFVMYADGSGMELLRDSDIEEYLSLAYKESNTVVLQEPV
QEQPGTLTITVLRPFHEASPWQVKKEDTIVPPNLRSRSWETFPSVEKKTPGPPFGTQIWK
GLCIESKQLVSAPGAILKSPSVLQMRQFIQHEVIKNEVKLRLQVSLKDYINYILKKEDEL
QEMMVKDSRTEEERGNAADLLKLVMSFPKMEETTKSHVTEVAAHLTDLFKQSLATPPKCP
PDTFGKDFFEKTWRHTASSKRWKEKIDKTRKEIETTQNYLMDIKNRIIPPFFKSELNQLY
QSQYNHLDSLSKKLPSFTKKNEDANETAVQDTSDLNLDFKPHKVSEQKSSSVPSLPKPEI
SADKKDFTAQNQTENLTKSPEEAESYEPVKIPTQSLLQDVAGQTRKEKVKLPHYLLSSKP
KSQPLAKVQDSVGGKVNTSSVASAAINNAKSSLFGFHLLPSSVKFGVLKEGHTYATVVKL
KNVGVDFCRFKVKQPPPSTGLKVTYKPGPVAAGMQTELNIELFATAVGEDGAKGSAHISH
NIEIMTEHEVLFLPVEATVLTSSNYDKRPKDFPQGKENPMVQRTSTIYSSTLGVFMSRKV
SPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5S003	0.642	0.616	0.000	2320	0.742	0.711	Q5S003.pdb.gz	SPG17_MOUSE Sperm-associated antigen 17 OS=Mus musculus OX=10090 GN=Spag17 PE=1 SV=2
2	PDB:7dvq3	0.051	0.067	2.824E-4	1193	0.036	0.068	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
3	AFDB:P91870	0.046	0.119	3.060E-4	824	0.034	0.091	P91870.pdb.gz	SPD2_CAEEL Spindle-defective protein 2 OS=Caenorhabditis elegans OX=6239 GN=spd-2 PE=1 SV=1
4	AFDB:Q80T85	0.043	0.077	7.664E-4	946	0.036	0.084	Q80T85.pdb.gz	DCAF5_MOUSE DDB1- and CUL4-associated factor 5 OS=Mus musculus OX=10090 GN=Dcaf5 PE=1 SV=2
5	PDB:7sqcO0	0.044	0.084	8.116E-4	1140	0.009	0.018	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
6	PDB:6lqsB1	0.032	0.067	2.802E-3	806	0.023	0.065	6lqsB1.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
7	PDB:7mq8LR	0.036	0.082	4.643E-3	773	0.022	0.062	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
8	PDB:6xt9I	0.039	0.083	5.328E-3	767	0.015	0.043	6xt9I.pdb.gz
9	AFDB:Q59E13	0.039	0.138	5.515E-3	522	0.025	0.107	Q59E13.pdb.gz	Q59E13_DROME Defective proboscis extension response 3, isoform B OS=Drosophila melanogaster OX=7227 GN=dpr3 PE=1 SV=2
10	PDB:2hyeA	0.037	0.054	5.579E-3	1140	0.035	0.068	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
11	AFDB:Q8CI52	0.034	0.083	6.938E-3	662	0.040	0.134	Q8CI52.pdb.gz	ASTRC_MOUSE Protein Aster-C OS=Mus musculus OX=10090 GN=Gramd1c PE=1 SV=2
12	AFDB:Q5U3Q5	0.042	0.080	7.962E-3	897	0.036	0.090	Q5U3Q5.pdb.gz	Q5U3Q5_DANRE Transducin beta-like protein 3 OS=Danio rerio OX=7955 GN=zgc:101778 PE=1 SV=1
13	PDB:7sqcO1	0.043	0.135	1.013E-2	673	0.008	0.027	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7ajtUM	0.042	0.080	1.334E-2	762	0.020	0.058	7ajtUM.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:7mq8LN	0.029	0.068	1.531E-2	671	0.021	0.070	7mq8LN.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	AFDB:Q9VI72	0.042	0.082	1.659E-2	901	0.059	0.145	Q9VI72.pdb.gz	Q9VI72_DROME Spindle assembly abnormal 4 OS=Drosophila melanogaster OX=7227 GN=Sas-4 PE=1 SV=2
17	PDB:7r5jW0	0.040	0.076	1.757E-2	735	0.046	0.139	7r5jW0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
18	AFDB:Q32P44	0.037	0.064	3.621E-2	896	0.034	0.085	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
19	AFDB:Q9FRK5	0.027	0.065	4.351E-2	617	0.022	0.078	Q9FRK5.pdb.gz	Y1514_ARATH Uncharacterized membrane protein At1g75140 OS=Arabidopsis thaliana OX=3702 GN=At1g75140 PE=1 SV=3
20	AFDB:F1NY98	0.032	0.034	4.555E-2	2034	0.050	0.055	F1NY98.pdb.gz	DSCAM_CHICK Cell adhesion molecule DSCAM OS=Gallus gallus OX=9031 GN=DSCAM PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5S003	0.0	2722	2320	0.656	0.629	SPG17_MOUSE Sperm-associated antigen 17 OS=Mus musculus OX=10090 GN=Spag17 PE=1 SV=2
2	Q8LPJ3	0.28	38.9	1024	0.024	0.052	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
3	Q13402	5.1	34.7	2215	0.013	0.013	MYO7A_HUMAN Unconventional myosin-VIIa OS=Homo sapiens OX=9606 GN=MYO7A PE=1 SV=2
4	P97479	6.2	34.7	2215	0.012	0.012	MYO7A_MOUSE Unconventional myosin-VIIa OS=Mus musculus OX=10090 GN=Myo7a PE=1 SV=2
5	A0A8J8XYU9	7.0	34.3	2215	0.012	0.012	A0A8J8XYU9_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
6	Q8CJE3	7.4	34.3	2177	0.012	0.012	Q8CJE3_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=2 SV=1
7	A0A8I5ZWB0	7.8	34.3	2238	0.012	0.012	A0A8I5ZWB0_RAT Myosin VIIA OS=Rattus norvegicus OX=10116 GN=Myo7a PE=3 SV=1
8	O76281	7.9	34.3	6658	0.017	0.006	O76281_DROME Projectin (Fragment) OS=Drosophila melanogaster OX=7227 GN=bt PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14874 PapD-like	9.3e-10	49.9	Flagellar-associated PapD-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365811	0.927	Sperm-associated antigen 6
2	9606.ENSP00000348314	0.867	Sperm flagellar protein 2
3	9606.ENSP00000321386	0.827	F-box only protein 39
4	9606.ENSP00000332592	0.794	Sperm-associated antigen 16 protein
5	9606.ENSP00000340982	0.793	Sperm-associated antigen 8
6	9606.ENSP00000393222	0.772	Cilia- and flagella-associated protein 221
7	9606.ENSP00000344749	0.745	Cilia- and flagella-associated protein 100
8	9606.ENSP00000358451	0.724	Ganglioside induced differentiation associated protein 2
9	9606.ENSP00000380679	0.721	Coiled-coil domain-containing protein 40
10	9606.ENSP00000358695	0.701	Cytochrome b5 reductase 4
11	9606.ENSP00000310829	0.689	Cilia- and flagella-associated protein 70
12	9606.ENSP00000331044	0.685	Enkurin
13	9606.ENSP00000273390	0.679	Cilia- and flagella-associated protein 91
14	9606.ENSP00000342169	0.677	Testis-expressed protein 9
15	9606.ENSP00000313243	0.673	Heat shock factor protein 5
16	9606.ENSP00000359799	0.661	DnaJ homolog subfamily B member 4
17	9606.ENSP00000480538	0.661	Dynein intermediate chain 1, axonemal
18	9606.ENSP00000377197	0.651	Hydrocephalus-inducing protein homolog
19	9606.ENSP00000308179	0.642	WD repeat-containing protein 3
20	9606.ENSP00000341346	0.642	Tektin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.984	cellular process
GO:0001578	0.970	microtubule bundle formation
GO:0051179	0.952	localization
GO:0060271	0.931	cilium assembly
GO:0051641	0.912	cellular localization
GO:0007018	0.910	microtubule-based movement
GO:0032501	0.909	multicellular organismal process
GO:0006810	0.900	transport
GO:0099111	0.872	microtubule-based transport
GO:0003341	0.862	cilium movement
GO:0048856	0.856	anatomical structure development
GO:0035082	0.838	axoneme assembly
GO:0044458	0.778	motile cilium assembly
GO:0048515	0.755	spermatid differentiation
GO:0007286	0.613	spermatid development
GO:0031503	0.611	protein-containing complex localization
GO:0051649	0.599	establishment of localization in cell
GO:0030705	0.578	cytoskeleton-dependent intracellular transport
GO:0033036	0.426	macromolecule localization
GO:0008104	0.423	protein localization
GO:0006858	0.318	extracellular transport
GO:0003351	0.314	epithelial cilium movement involved in extracellular fluid movement

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0012505	0.999	endomembrane system
GO:0099503	0.998	secretory vesicle
GO:0015630	0.996	microtubule cytoskeleton
GO:0005794	0.991	Golgi apparatus
GO:0005930	0.988	axoneme
GO:0001669	0.986	acrosomal vesicle
GO:0002177	0.754	manchette
GO:1990716	0.754	axonemal central apparatus
GO:0031974	0.642	membrane-enclosed lumen
GO:0043233	0.627	organelle lumen
GO:0070013	0.610	intracellular organelle lumen
GO:0005634	0.497	nucleus
GO:0031981	0.434	nuclear lumen
GO:0005654	0.393	nucleoplasm
GO:0016020	0.366	membrane
GO:0097729	0.324	9+2 motile cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]