StarFunc result for job id Q6Q788

User Input

>input (366 residues)
MASMAAVLTWALALLSAFSATQARKGFWDYFSQTSGDKGRVEQIHQQKMAREPATLKDSL
EQDLNNMNKFLEKLRPLSGSEAPRLPQDPVGMRRQLQEELEEVKARLQPYMAEAHELVGW
NLEGLRQQLKPYTMDLMEQVALRVQELQEQLRVVGEDTKAQLLGGVDEAWALLQGLQSRV
VHHTGRFKELFHPYAESLVSGIGRHVQELHRSVAPHAPASPARLSRCVQVLSRKLTLKAK
ALHARIQQNLDQLREELSRAFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFT
RAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGH
SHLGDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6Q788	1.000	1.000	2.425E-46	366	1.000	1.000	Q6Q788.pdb.gz	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
2	AFDB:Q8C7G5	0.673	0.670	1.879E-28	368	0.716	0.712	Q8C7G5.pdb.gz	APOA5_MOUSE Apolipoprotein A-V OS=Mus musculus OX=10090 GN=Apoa5 PE=1 SV=1
3	AFDB:P02651	0.328	0.308	2.675E-4	391	0.235	0.220	P02651.pdb.gz	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
4	AFDB:P06727	0.371	0.344	2.675E-4	396	0.276	0.255	P06727.pdb.gz	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
5	AFDB:P06728	0.365	0.341	3.906E-4	395	0.240	0.223	P06728.pdb.gz	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
6	AFDB:Q56XQ0	0.194	0.186	6.067E-3	393	0.126	0.117	Q56XQ0.pdb.gz	U496I_ARATH UPF0496 protein At2g18630 OS=Arabidopsis thaliana OX=3702 GN=At2g18630 PE=2 SV=3
7	AFDB:Q9R0T8	0.136	0.082	1.638E-2	717	0.093	0.047	Q9R0T8.pdb.gz	IKKE_MOUSE Inhibitor of nuclear factor kappa-B kinase subunit epsilon OS=Mus musculus OX=10090 GN=Ikbke PE=1 SV=2
8	AFDB:Q87ID1	0.201	0.089	2.628E-2	988	0.148	0.055	Q87ID1.pdb.gz	Q87ID1_VIBPA Phosphorelay protein LuxU OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=VPA0675 PE=1 SV=1
9	AFDB:O74786	0.106	0.096	3.490E-2	419	0.117	0.103	O74786.pdb.gz	SEC9_SCHPO Protein transport protein sec9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec9 PE=1 SV=1
10	AFDB:P18588	0.192	0.123	3.490E-2	652	0.112	0.063	P18588.pdb.gz	MX1_RAT Interferon-induced GTP-binding protein Mx1 OS=Rattus norvegicus OX=10116 GN=Mx1 PE=1 SV=1
11	PDB:5wp9A	0.246	0.167	5.793E-2	590	0.096	0.059	5wp9A.pdb.gz	Structural basis of mitochondrial receptor binding and constriction by DRP1.
12	PDB:3szrA	0.296	0.212	6.676E-2	559	0.096	0.063	3szrA.pdb.gz
13	PDB:7ax3A	0.132	0.088	8.067E-2	587	0.098	0.061	7ax3A.pdb.gz	CryoEM structure of the super-constricted two-start dynamin 1 filament.
14	PDB:6xz6A	0.160	0.245	9.746E-2	213	0.093	0.160	6xz6A.pdb.gz
15	PDB:5gtmB	0.204	0.155	1.890E-1	522	0.090	0.063	5gtmB.pdb.gz
16	PDB:5sv0A	0.174	0.250	1.890E-1	233	0.079	0.124	5sv0A.pdb.gz
17	PDB:2j68A	0.279	0.171	2.283E-1	680	0.104	0.056	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
18	PDB:7yqcA	0.204	0.330	2.892E-1	198	0.049	0.091	7yqcA.pdb.gz
19	PDB:5bpwA	0.220	0.145	3.032E-1	659	0.079	0.044	5bpwA.pdb.gz
20	PDB:3ipmO	0.190	0.280	3.333E-1	219	0.082	0.137	3ipmO.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6Q788	0.0	743	366	1.000	1.000	APOA5_HUMAN Apolipoprotein A-V OS=Homo sapiens OX=9606 GN=APOA5 PE=1 SV=1
2	Q8C7G5	0.0	515	368	0.732	0.728	APOA5_MOUSE Apolipoprotein A-V OS=Mus musculus OX=10090 GN=Apoa5 PE=1 SV=1
3	Q9QUH3	3.08e-180	506	367	0.710	0.708	APOA5_RAT Apolipoprotein A-V OS=Rattus norvegicus OX=10116 GN=Apoa5 PE=1 SV=1
4	P06727	3.98e-27	112	396	0.265	0.245	APOA4_HUMAN Apolipoprotein A-IV OS=Homo sapiens OX=9606 GN=APOA4 PE=1 SV=4
5	P06728	1.37e-24	105	395	0.227	0.210	APOA4_MOUSE Apolipoprotein A-IV OS=Mus musculus OX=10090 GN=Apoa4 PE=1 SV=3
6	P02651	4.35e-24	104	391	0.251	0.235	APOA4_RAT Apolipoprotein A-IV OS=Rattus norvegicus OX=10116 GN=Apoa4 PE=1 SV=2
7	P02647	3.38e-09	59.3	267	0.158	0.217	APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1
8	P09809	1.58e-07	54.3	266	0.167	0.229	APOA1_RABIT Apolipoprotein A-I OS=Oryctolagus cuniculus OX=9986 GN=APOA1 PE=1 SV=2
9	Q00623	3.21e-06	50.4	264	0.123	0.170	APOA1_MOUSE Apolipoprotein A-I OS=Mus musculus OX=10090 GN=Apoa1 PE=1 SV=2
10	P08250	9.09e-06	48.9	264	0.117	0.163	APOA1_CHICK Apolipoprotein A-I OS=Gallus gallus OX=9031 GN=APOA1 PE=1 SV=2
11	G5BQH5	9.17e-06	48.9	264	0.079	0.110	APOA1_HETGA Apolipoprotein A-I OS=Heterocephalus glaber OX=10181 GN=Apoa1 PE=1 SV=2
12	P18648	1.38e-05	48.5	265	0.145	0.200	APOA1_PIG Apolipoprotein A-I OS=Sus scrofa OX=9823 GN=APOA1 PE=1 SV=4
13	O57523	3.30e-05	47.4	262	0.093	0.130	APA11_ONCMY Apolipoprotein A-I-1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
14	E3TE55	3.32e-05	47.4	258	0.104	0.147	E3TE55_ICTPU Apolipoprotein A-I OS=Ictalurus punctatus OX=7998 GN=APOA1 PE=2 SV=1
15	P04639	2.53e-04	44.7	259	0.123	0.174	APOA1_RAT Apolipoprotein A-I OS=Rattus norvegicus OX=10116 GN=Apoa1 PE=1 SV=2
16	O42363	6.71e-04	43.1	262	0.079	0.111	APOA1_DANRE Apolipoprotein A-I OS=Danio rerio OX=7955 GN=apoa1 PE=1 SV=1
17	P08226	0.005	40.8	311	0.090	0.106	APOE_MOUSE Apolipoprotein E OS=Mus musculus OX=10090 GN=Apoe PE=1 SV=2
18	Q98SI3	0.024	37.7	174	0.079	0.167	Q98SI3_CYPCA Apolipoprotein A-I (Fragment) OS=Cyprinus carpio OX=7962 GN=apoA1 PE=2 SV=1
19	P02650	0.042	37.7	312	0.112	0.131	APOE_RAT Apolipoprotein E OS=Rattus norvegicus OX=10116 GN=Apoe PE=1 SV=2
20	F1LW07	0.097	37.4	825	0.126	0.056	F1LW07_RAT Protein phosphatase 1, regulatory subunit 13 like OS=Rattus norvegicus OX=10116 GN=Ppp1r13l PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01442 Apolipoprotein	8.2e-61	216.7	Apolipoprotein A1/A4/E domain
2	PF07464 ApoLp-III	1.3e+02	14.2	Apolipophorin-III precursor (apoLp-III)
3	PF19697 Atg11_middle	7e+02	11.9	Atg11 middle domain
4	PF04513 Baculo_PEP_C	6.5e+02	11.8	Baculovirus polyhedron envelope protein, PEP, C terminus
5	PF07889 DUF1664	5.4e+02	12.0	Protein of unknown function (DUF1664)
6	PF08939 DUF1917	2.3e+02	13.1	Domain of unknown function (DUF1917)
7	PF14644 DUF4456	39	15.5	Domain of unknown function (DUF4456)
8	PF02601 Exonuc_VII_L	11	17.0	Exonuclease VII, large subunit
9	PF18476 PIN_8	39	15.6	PIN like domain
10	PF12732 YtxH	33	16.5	YtxH-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000445002

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227667	0.993	Apolipoprotein C-III
2	9606.ENSP00000233242	0.989	Apolipoprotein B-100
3	9606.ENSP00000480053	0.985	Glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1
4	9606.ENSP00000252486	0.984	Apolipoprotein E
5	9606.ENSP00000466775	0.983	Apolipoprotein C-II
6	9606.ENSP00000356969	0.972	Apolipoprotein A-II
7	9606.ENSP00000309757	0.971	Lipoprotein lipase
8	9606.ENSP00000385523	0.963	Peroxisome proliferator-activated receptor alpha
9	9606.ENSP00000078445	0.956	Cyclic AMP-responsive element-binding protein 3-like protein 3
10	9606.ENSP00000236850	0.954	Apolipoprotein A-I
11	9606.ENSP00000350425	0.937	Apolipoprotein A-IV
12	9606.ENSP00000373328	0.936	Cell death activator CIDE-3
13	9606.ENSP00000454071	0.935	Low-density lipoprotein receptor
14	9606.ENSP00000471477	0.933	Fibroblast growth factor 21
15	9606.ENSP00000200676	0.931	Cholesteryl ester transfer protein
16	9606.ENSP00000274793	0.920	Platelet-activating factor acetylhydrolase
17	9606.ENSP00000321334	0.917	Apolipoprotein(a)
18	9606.ENSP00000465356	0.912	Apolipoprotein C-I
19	9606.ENSP00000419692	0.911	Retinoic acid receptor RXR-alpha
20	9606.ENSP00000217964	0.906	F-box-like/WD repeat-containing protein TBL1X

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.999	enzyme binding
GO:0050750	0.999	low-density lipoprotein particle receptor binding
GO:0008201	0.999	heparin binding
GO:0031210	0.999	phosphatidylcholine binding
GO:0060229	0.997	lipase activator activity
GO:0035473	0.963	lipase binding
GO:0060230	0.947	lipoprotein lipase activator activity
GO:0042802	0.660	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0050789	0.992	regulation of biological process
GO:0048518	0.982	positive regulation of biological process
GO:0051179	0.978	localization
GO:0033036	0.972	macromolecule localization
GO:0050794	0.971	regulation of cellular process
GO:0065009	0.965	regulation of molecular function
GO:0044237	0.963	cellular metabolic process
GO:0010876	0.961	lipid localization
GO:0048878	0.944	chemical homeostasis
GO:0009893	0.939	positive regulation of metabolic process
GO:0006869	0.939	lipid transport
GO:0031323	0.937	regulation of cellular metabolic process
GO:0097006	0.933	regulation of plasma lipoprotein particle levels
GO:0032879	0.933	regulation of localization
GO:0032501	0.931	multicellular organismal process
GO:0006641	0.926	triglyceride metabolic process
GO:0080090	0.925	regulation of primary metabolic process
GO:0055088	0.924	lipid homeostasis
GO:0071827	0.913	plasma lipoprotein particle organization
GO:0048522	0.891	positive regulation of cellular process
GO:0051336	0.887	regulation of hydrolase activity
GO:0019216	0.883	regulation of lipid metabolic process
GO:0055090	0.878	acylglycerol homeostasis
GO:0042632	0.874	cholesterol homeostasis
GO:0048856	0.858	anatomical structure development
GO:0050896	0.844	response to stimulus
GO:0051049	0.843	regulation of transport
GO:0060191	0.834	regulation of lipase activity
GO:0031099	0.812	regeneration
GO:0062012	0.812	regulation of small molecule metabolic process
GO:0009889	0.804	regulation of biosynthetic process
GO:0090207	0.799	regulation of triglyceride metabolic process
GO:0031325	0.797	positive regulation of cellular metabolic process
GO:0070328	0.790	triglyceride homeostasis
GO:0045834	0.784	positive regulation of lipid metabolic process
GO:0031326	0.775	regulation of cellular biosynthetic process
GO:0046503	0.775	glycerolipid catabolic process
GO:0046464	0.746	acylglycerol catabolic process
GO:0009891	0.740	positive regulation of biosynthetic process
GO:0051239	0.698	regulation of multicellular organismal process
GO:0010565	0.685	regulation of cellular ketone metabolic process
GO:0019217	0.602	regulation of fatty acid metabolic process
GO:0031328	0.593	positive regulation of cellular biosynthetic process
GO:0006807	0.517	nitrogen compound metabolic process
GO:0051050	0.488	positive regulation of transport
GO:0009894	0.487	regulation of catabolic process
GO:0051128	0.459	regulation of cellular component organization
GO:0048519	0.444	negative regulation of biological process
GO:0046890	0.442	regulation of lipid biosynthetic process
GO:0009896	0.414	positive regulation of catabolic process
GO:0050994	0.392	regulation of lipid catabolic process
GO:0062013	0.385	positive regulation of small molecule metabolic process
GO:0046889	0.379	positive regulation of lipid biosynthetic process
GO:0050996	0.377	positive regulation of lipid catabolic process
GO:0042304	0.376	regulation of fatty acid biosynthetic process
GO:0045923	0.367	positive regulation of fatty acid metabolic process
GO:1901564	0.359	organonitrogen compound metabolic process
GO:0060627	0.356	regulation of vesicle-mediated transport
GO:0090208	0.355	positive regulation of triglyceride metabolic process
GO:0045723	0.351	positive regulation of fatty acid biosynthetic process
GO:0048523	0.344	negative regulation of cellular process
GO:0044093	0.327	positive regulation of molecular function
GO:0051716	0.325	cellular response to stimulus
GO:0043085	0.321	positive regulation of catalytic activity
GO:0051240	0.317	positive regulation of multicellular organismal process
GO:0043170	0.308	macromolecule metabolic process
GO:0060255	0.307	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0005737	0.998	cytoplasm
GO:0070013	0.996	intracellular organelle lumen
GO:0012505	0.995	endomembrane system
GO:0032991	0.992	protein-containing complex
GO:0032994	0.978	protein-lipid complex
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0034358	0.949	plasma lipoprotein particle
GO:0005829	0.890	cytosol
GO:0005783	0.861	endoplasmic reticulum
GO:0034385	0.804	triglyceride-rich plasma lipoprotein particle
GO:0034361	0.788	very-low-density lipoprotein particle
GO:0034364	0.673	high-density lipoprotein particle
GO:0005788	0.655	endoplasmic reticulum lumen
GO:0042627	0.433	chylomicron
GO:0031981	0.431	nuclear lumen
GO:0005654	0.317	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]