StarFunc result for job id Q6QEF8

User Input

>input (472 residues)
MSRRVVRQSKFRHVFGQAAKADQAYEDIRVSKVTWDSSFCAVNPKFLAIIVEAGGGGAFI
VLPLAKTGRVDKNYPLVTGHTAPVLDIDWCPHNDNVIASASDDTTIMVWQIPDYTPMRNI
TEPIITLEGHSKRVGILSWHPTARNVLLSAGGDNVIIIWNVGTGEVLLSLDDMHPDVIHS
VCWNSNGSLLATTCKDKTLRIIDPRKGQVVAEQARPHEGARPLRAVFTADGKLLSTGFSR
MSERQLALWDPNNFEEPVALQEMDTSNGVLLPFYDPDSSIVYLCGKGDSSIRYFEITDEP
PFVHYLNTFSSKEPQRGMGFMPKRGLDVSKCEIARFYKLHERKCEPIIMTVPRKSDLFQD
DLYPDTPGPEPALEADEWLSGQDAEPVLISLRDGYVPPKHRELRVTKRNILDVRPPSGPR
RSQSASDAPLSQQHTLETLLEEIKALRERVQAQEQRITALENMLCELVDGTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6QEF8	1.000	1.000	3.806E-99	472	1.000	1.000	Q6QEF8.pdb.gz	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
2	AFDB:Q9ULV4	0.888	0.884	1.829E-79	474	0.689	0.686	Q9ULV4.pdb.gz	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
3	AFDB:B0R0D7	0.904	0.901	6.857E-79	474	0.691	0.688	B0R0D7.pdb.gz	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
4	AFDB:Q9BR76	0.833	0.804	6.927E-78	489	0.695	0.671	Q9BR76.pdb.gz	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
5	AFDB:Q7SX58	0.832	0.863	6.178E-73	455	0.619	0.642	Q7SX58.pdb.gz	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
6	AFDB:G8G223	0.859	0.879	1.964E-72	461	0.644	0.659	G8G223.pdb.gz	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
7	PDB:7styA	0.815	0.985	1.294E-69	390	0.633	0.767	7styA.pdb.gz
8	AFDB:A0A0B4KEJ7	0.850	0.751	2.487E-65	535	0.549	0.484	A0A0B4KEJ7.pdb.gz	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
9	AFDB:P27133	0.814	0.863	4.679E-57	445	0.398	0.422	P27133.pdb.gz	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
10	AFDB:Q92828	0.825	0.744	6.880E-57	525	0.453	0.408	Q92828.pdb.gz	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
11	AFDB:Q8BH44	0.816	0.802	7.269E-57	480	0.449	0.442	Q8BH44.pdb.gz	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
12	PDB:2h9lA	0.494	0.702	4.105E-15	321	0.136	0.199	2h9lA.pdb.gz
13	PDB:5nnzA	0.477	0.646	4.337E-15	335	0.129	0.182	5nnzA.pdb.gz
14	PDB:7bt6x	0.465	0.451	6.442E-14	488	0.123	0.119	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
15	PDB:5mzhB	0.488	0.547	7.599E-14	415	0.138	0.157	5mzhB.pdb.gz
16	PDB:5yzgs	0.446	0.553	7.599E-14	374	0.110	0.139	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
17	PDB:4bzjC	0.525	0.369	1.471E-13	693	0.110	0.075	4bzjC.pdb.gz
18	PDB:7uwfA	0.470	0.603	2.047E-13	361	0.078	0.102	7uwfA.pdb.gz
19	PDB:7zgrD	0.507	0.593	2.047E-13	395	0.110	0.132	7zgrD.pdb.gz	Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
20	PDB:5o9zL	0.444	0.456	2.163E-13	459	0.108	0.111	5o9zL.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KEJ7	0.0	531	535	0.551	0.486	A0A0B4KEJ7_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
2	A0A0B4KEU5	0.0	528	534	0.549	0.485	A0A0B4KEU5_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
3	B0R0D7	0.0	724	474	0.693	0.690	COR1C_DANRE Coronin-1C-A OS=Danio rerio OX=7955 GN=coro1ca PE=2 SV=1
4	G8G223	0.0	655	461	0.663	0.679	G8G223_PIG Coronin OS=Sus scrofa OX=9823 GN=coro1a PE=3 SV=1
5	O89046	0.0	710	484	0.695	0.678	COR1B_RAT Coronin-1B OS=Rattus norvegicus OX=10116 GN=Coro1b PE=1 SV=1
6	O89053	0.0	662	461	0.665	0.681	COR1A_MOUSE Coronin-1A OS=Mus musculus OX=10090 GN=Coro1a PE=1 SV=5
7	P31146	0.0	662	461	0.669	0.685	COR1A_HUMAN Coronin-1A OS=Homo sapiens OX=9606 GN=CORO1A PE=1 SV=4
8	Q6QEF8	0.0	978	472	1.000	1.000	CORO6_HUMAN Coronin-6 OS=Homo sapiens OX=9606 GN=CORO6 PE=1 SV=2
9	Q7JVY0	0.0	535	528	0.549	0.491	Q7JVY0_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=coro PE=1 SV=1
10	Q7SX58	0.0	653	455	0.623	0.646	Q7SX58_DANRE Coronin OS=Danio rerio OX=7955 GN=fj83g12 PE=1 SV=1
11	Q9BR76	0.0	708	489	0.697	0.673	COR1B_HUMAN Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1
12	Q9ULV4	0.0	720	474	0.689	0.686	COR1C_HUMAN Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1
13	Q9WUM3	0.0	715	484	0.699	0.682	COR1B_MOUSE Coronin-1B OS=Mus musculus OX=10090 GN=Coro1b PE=1 SV=1
14	Q9WUM4	0.0	723	474	0.693	0.690	COR1C_MOUSE Coronin-1C OS=Mus musculus OX=10090 GN=Coro1c PE=1 SV=2
15	Q8BH44	7.19e-146	427	480	0.460	0.452	COR2B_MOUSE Coronin-2B OS=Mus musculus OX=10090 GN=Coro2b PE=1 SV=2
16	Q9UQ03	2.71e-144	423	480	0.458	0.450	COR2B_HUMAN Coronin-2B OS=Homo sapiens OX=9606 GN=CORO2B PE=1 SV=4
17	Q92828	1.20e-139	413	525	0.436	0.392	COR2A_HUMAN Coronin-2A OS=Homo sapiens OX=9606 GN=CORO2A PE=1 SV=2
18	Q8C0P5	2.28e-135	402	524	0.405	0.365	COR2A_MOUSE Coronin-2A OS=Mus musculus OX=10090 GN=Coro2a PE=2 SV=1
19	P27133	2.63e-131	389	445	0.407	0.431	COROA_DICDI Coronin-A OS=Dictyostelium discoideum OX=44689 GN=corA PE=1 SV=2
20	O13923	3.17e-117	358	601	0.377	0.296	CORO_SCHPO Coronin-like protein crn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=crn1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.7e-06	39.5	Anaphase-promoting complex subunit 4 WD40 domain
2	PF04053 Coatomer_WDAD	4.4e+02	11.3	Coatomer WD associated region
3	PF08953 DUF1899	5.7e-27	104.7	Domain of unknown function (DUF1899)
4	PF20426 NBCH_WD40	0.0069	26.9	Neurobeachin beta propeller domain
5	PF08954 Trimer_CC	9.5	17.2	Trimerisation motif
6	PF00400 WD40	3.2e-14	64.3	WD domain, G-beta repeat
7	PF16300 WD40_4	1.8e-20	83.8	Type of WD40 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9685.ENSFCAP00000002536

Rank	PPI partner	STRING score	Description
1	9685.ENSFCAP00000004589	0.644	ARP2 actin-related protein 2 homolog (yeast)
2	9685.ENSFCAP00000008416	0.639	Myosin IG
3	9685.ENSFCAP00000018370	0.579	Synaptopodin 2-like
4	9685.ENSFCAP00000010103	0.577	Synaptotagmin-like 5
5	9685.ENSFCAP00000013931	0.575	LIM domain binding 3
6	9685.ENSFCAP00000008466	0.574	AKT interacting protein
7	9685.ENSFCAP00000013327	0.574	Checkpoint kinase 2
8	9685.ENSFCAP00000023506	0.574	Uncharacterized protein
9	9685.ENSFCAP00000013315	0.572	Kelch-like family member 31
10	9685.ENSFCAP00000002848	0.515	Gelsolin
11	9685.ENSFCAP00000005262	0.515	Bridging integrator 3
12	9685.ENSFCAP00000019891	0.505	RNA binding motif protein 24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.965	cytoskeletal protein binding
GO:0003779	0.952	actin binding
GO:0051015	0.914	actin filament binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0032956	0.978	regulation of actin cytoskeleton organization
GO:1902903	0.968	regulation of supramolecular fiber organization
GO:0030029	0.952	actin filament-based process
GO:0071840	0.951	cellular component organization or biogenesis
GO:0016043	0.941	cellular component organization
GO:0040012	0.930	regulation of locomotion
GO:0050896	0.923	response to stimulus
GO:0048519	0.917	negative regulation of biological process
GO:0110053	0.909	regulation of actin filament organization
GO:0048523	0.898	negative regulation of cellular process
GO:0032502	0.875	developmental process
GO:0030036	0.846	actin cytoskeleton organization
GO:0051179	0.819	localization
GO:0048518	0.772	positive regulation of biological process
GO:0048583	0.771	regulation of response to stimulus
GO:0007162	0.739	negative regulation of cell adhesion
GO:0010812	0.731	negative regulation of cell-substrate adhesion
GO:0044087	0.727	regulation of cellular component biogenesis
GO:0048522	0.724	positive regulation of cellular process
GO:0048856	0.684	anatomical structure development
GO:0070727	0.672	cellular macromolecule localization
GO:0071363	0.655	cellular response to growth factor stimulus
GO:0051336	0.653	regulation of hydrolase activity
GO:0051129	0.651	negative regulation of cellular component organization
GO:0051130	0.620	positive regulation of cellular component organization
GO:0051234	0.589	establishment of localization
GO:0032501	0.573	multicellular organismal process
GO:0030336	0.571	negative regulation of cell migration
GO:1902743	0.530	regulation of lamellipodium organization
GO:0006810	0.497	transport
GO:1902745	0.470	positive regulation of lamellipodium organization
GO:0019222	0.461	regulation of metabolic process
GO:0016192	0.422	vesicle-mediated transport
GO:0060255	0.417	regulation of macromolecule metabolic process
GO:0007015	0.378	actin filament organization
GO:0032231	0.330	regulation of actin filament bundle assembly
GO:0051171	0.315	regulation of nitrogen compound metabolic process
GO:0080090	0.314	regulation of primary metabolic process
GO:0051716	0.312	cellular response to stimulus
GO:0031323	0.305	regulation of cellular metabolic process
GO:0010639	0.305	negative regulation of organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.997	membrane-bounded organelle
GO:0005737	0.997	cytoplasm
GO:0043229	0.997	intracellular organelle
GO:0043228	0.995	non-membrane-bounded organelle
GO:0005856	0.990	cytoskeleton
GO:0005829	0.985	cytosol
GO:0071944	0.984	cell periphery
GO:0032991	0.979	protein-containing complex
GO:0016020	0.978	membrane
GO:0005576	0.967	extracellular region
GO:0042995	0.965	cell projection
GO:0120025	0.961	plasma membrane bounded cell projection
GO:0005886	0.955	plasma membrane
GO:0005615	0.938	extracellular space
GO:0070062	0.931	extracellular exosome
GO:0015629	0.928	actin cytoskeleton
GO:0031252	0.924	cell leading edge
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0012505	0.911	endomembrane system
GO:0030054	0.892	cell junction
GO:0030027	0.840	lamellipodium
GO:0070161	0.814	anchoring junction
GO:0030055	0.787	cell-substrate junction
GO:0005925	0.765	focal adhesion
GO:0099080	0.715	supramolecular complex
GO:0099513	0.490	polymeric cytoskeletal fiber
GO:0048471	0.473	perinuclear region of cytoplasm
GO:0005938	0.446	cell cortex
GO:0001725	0.389	stress fiber
GO:0005884	0.386	actin filament
GO:0032587	0.375	ruffle membrane
GO:0005634	0.339	nucleus
GO:0098796	0.335	membrane protein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]