StarFunc result for job id Q6QHC5

User Input

>input (323 residues)
MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVLVLVQMLACWL
VRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTGRAARNRWLAVFANLPVGVPY
AASFKKYHVDHHRYLGGDGLDVDVPTRLEGWFFCTPARKLLWLVLQPFFYSLRPLCVHPK
AVTRMEVLNTLVQLAADLAIFALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGH
ETYSYYGPLNWITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDF
VFEDSLGPYARVKRVYRLAKDGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6QHC5	1.000	1.000	2.628E-50	323	1.000	1.000	Q6QHC5.pdb.gz	DEGS2_HUMAN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Homo sapiens OX=9606 GN=DEGS2 PE=1 SV=2
2	AFDB:Q8R2F2	0.991	0.991	1.498E-45	323	0.864	0.864	Q8R2F2.pdb.gz	DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus OX=10090 GN=Degs2 PE=1 SV=1
3	AFDB:Q5F3C1	0.979	0.979	3.388E-39	323	0.663	0.663	Q5F3C1.pdb.gz	DEGS1_CHICK Sphingolipid delta(4)-desaturase DES1 OS=Gallus gallus OX=9031 GN=DEGS1 PE=1 SV=1
4	AFDB:A0A024R3P1	0.979	0.979	2.040E-38	323	0.635	0.635	A0A024R3P1.pdb.gz
5	AFDB:O09005	0.976	0.976	7.168E-38	323	0.616	0.616	O09005.pdb.gz	DEGS1_MOUSE Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1
6	AFDB:Q94515	0.977	0.983	2.343E-35	321	0.573	0.576	Q94515.pdb.gz	DEGS1_DROME Sphingolipid delta(4)-desaturase DES1 OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1
7	AFDB:Q9ZPH4	0.953	0.927	1.277E-30	332	0.440	0.428	Q9ZPH4.pdb.gz	DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana OX=3702 GN=At4g04930 PE=2 SV=1
8	AFDB:O59715	0.935	0.836	1.447E-26	362	0.402	0.359	O59715.pdb.gz	DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsd1 PE=1 SV=1
9	AFDB:Q55D94	0.926	0.831	1.219E-20	361	0.319	0.285	Q55D94.pdb.gz	Q55D94_DICDI sphingolipid 4-desaturase OS=Dictyostelium discoideum OX=44689 GN=desA PE=3 SV=1
10	AFDB:A4KDP0	0.606	0.479	4.218E-9	425	0.198	0.151	A4KDP0.pdb.gz	D5FAD_REBSA Acyl-lipid (8-3)-desaturase OS=Rebecca salina OX=561169 GN=D5Des PE=1 SV=1
11	PDB:7cmhB	0.169	0.133	6.746E-1	458	0.130	0.092	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
12	PDB:1fz0C	0.141	0.124	8.831E-1	388	0.115	0.095	1fz0C.pdb.gz	Crystal structures of the soluble methane monooxygenase hydroxylase from Methylococcus capsulatus (Bath) demonstrating geometrical variability at the dinuclear iron active site.
13	PDB:4i91A	0.120	0.099	1.057	465	0.068	0.047	4i91A.pdb.gz	Structural and Thermodynamic Basis of (+)-alpha-Pinene Binding to Human Cytochrome P450 2B6.
14	PDB:8d1iD	0.121	0.109	1.105	376	0.102	0.088	8d1iD.pdb.gz	Structures and gating mechanisms of human bestrophin anion channels.
15	PDB:6f7hD	0.150	0.175	1.209	256	0.111	0.141	6f7hD.pdb.gz	Human adipose glycerol flux is regulated by a pH gate in AQP10.
16	PDB:7xk7D	0.135	0.185	1.513	206	0.087	0.136	7xk7D.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.
17	PDB:3wojA	0.126	0.070	1.583	698	0.124	0.057	3wojA.pdb.gz	S46 peptidases are the first exopeptidases to be members of clan PA
18	PDB:4rp9A	0.105	0.084	1.894	451	0.127	0.091	4rp9A.pdb.gz	Crystal structure of a phosphorylation-coupled vitamin C transporter.
19	PDB:3rm5A	0.115	0.080	1.981	521	0.068	0.042	3rm5A.pdb.gz
20	PDB:3t3zA	0.141	0.108	2.072	464	0.096	0.067	3t3zA.pdb.gz	Structural comparison of cytochromes P450 2A6, 2A13, and 2E1 with pilocarpine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6QHC5	0.0	661	323	1.000	1.000	DEGS2_HUMAN Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Homo sapiens OX=9606 GN=DEGS2 PE=1 SV=2
2	Q8R2F2	0.0	577	323	0.864	0.864	DEGS2_MOUSE Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2 OS=Mus musculus OX=10090 GN=Degs2 PE=1 SV=1
3	Q5F3C1	2.34e-174	488	323	0.663	0.663	DEGS1_CHICK Sphingolipid delta(4)-desaturase DES1 OS=Gallus gallus OX=9031 GN=DEGS1 PE=1 SV=1
4	O15121	2.72e-160	452	323	0.635	0.635	DEGS1_HUMAN Sphingolipid delta(4)-desaturase DES1 OS=Homo sapiens OX=9606 GN=DEGS1 PE=1 SV=1
5	O09005	1.76e-155	439	323	0.616	0.616	DEGS1_MOUSE Sphingolipid delta(4)-desaturase DES1 OS=Mus musculus OX=10090 GN=Degs1 PE=1 SV=1
6	Q94515	9.11e-140	400	321	0.567	0.570	DEGS1_DROME Sphingolipid delta(4)-desaturase DES1 OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1
7	Q9ZPH4	1.14e-102	306	332	0.446	0.434	DES1L_ARATH Sphingolipid delta(4)-desaturase DES1-like OS=Arabidopsis thaliana OX=3702 GN=At4g04930 PE=2 SV=1
8	O59715	1.42e-77	243	362	0.406	0.362	DEGS_SCHPO Sphingolipid delta(4)-desaturase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dsd1 PE=1 SV=1
9	M9PC47	3.03e-47	156	102	0.207	0.657	M9PC47_DROME Infertile crescent, isoform B OS=Drosophila melanogaster OX=7227 GN=ifc PE=1 SV=1
10	Q55D94	4.12e-37	138	361	0.319	0.285	Q55D94_DICDI sphingolipid 4-desaturase OS=Dictyostelium discoideum OX=44689 GN=desA PE=3 SV=1
11	G5EG11	2.2	32.3	447	0.037	0.027	FAT4_CAEEL Delta(5) fatty acid desaturase fat-4 OS=Caenorhabditis elegans OX=6239 GN=fat-4 PE=1 SV=1
12	P48623	2.6	32.3	386	0.053	0.044	FAD3E_ARATH Acyl-lipid omega-3 desaturase (cytochrome b5), endoplasmic reticulum OS=Arabidopsis thaliana OX=3702 GN=FAD3 PE=1 SV=1
13	Q920R3	2.7	32.3	447	0.040	0.029	FADS1_RAT Acyl-CoA (8-3)-desaturase OS=Rattus norvegicus OX=10116 GN=Fads1 PE=1 SV=1
14	Q920L1	2.8	32.0	447	0.040	0.029	FADS1_MOUSE Acyl-CoA (8-3)-desaturase OS=Mus musculus OX=10090 GN=Fads1 PE=1 SV=1
15	P25931	3.5	32.0	464	0.065	0.045	RYAR_DROME RYamide receptor OS=Drosophila melanogaster OX=7227 GN=RYa-R PE=2 SV=2
16	P46310	4.2	31.6	446	0.046	0.034	FAD3C_ARATH sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FAD7 PE=1 SV=1
17	Q56VS4	5.3	31.2	443	0.046	0.034	FAD3C_HELAN sn-2 acyl-lipid omega-3 desaturase (ferredoxin), chloroplastic OS=Helianthus annuus OX=4232 GN=FAD7 PE=1 SV=1
18	P51871	5.5	31.2	537	0.059	0.035	CP4F6_RAT Cytochrome P450 4F6 OS=Rattus norvegicus OX=10116 GN=Cyp4f6 PE=2 SV=1
19	Q9Z0R9	5.8	31.2	444	0.040	0.029	FADS2_MOUSE Acyl-CoA 6-desaturase OS=Mus musculus OX=10090 GN=Fads2 PE=1 SV=1
20	Q9Z122	6.1	31.2	444	0.040	0.029	FADS2_RAT Acyl-CoA 6-desaturase OS=Rattus norvegicus OX=10116 GN=Fads2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00487 FA_desaturase	8.8e-22	89.7	Fatty acid desaturase
2	PF08557 Lipid_DES	4.8e-16	69.3	Sphingolipid Delta4-desaturase (DES)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307126

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000434480	0.979	Alkaline ceramidase 3
2	9606.ENSP00000354829	0.975	Phosphatidylcholine:ceramide cholinephosphotransferase 1
3	9606.ENSP00000315137	0.971	Sphingosine-1-phosphate phosphatase 2
4	9606.ENSP00000363397	0.966	Ceramide glucosyltransferase
5	9606.ENSP00000251363	0.965	Ceramide synthase 4
6	9606.ENSP00000342609	0.965	Alkaline ceramidase 2
7	9606.ENSP00000376453	0.965	Ceramide synthase 6
8	9606.ENSP00000284382	0.963	Ceramide synthase 3
9	9606.ENSP00000271688	0.962	Ceramide synthase 2
10	9606.ENSP00000385083	0.962	3-ketodihydrosphingosine reductase
11	9606.ENSP00000325485	0.961	Ceramide synthase 5
12	9606.ENSP00000313681	0.958	Sphingosine kinase 1
13	9606.ENSP00000301452	0.956	Alkaline ceramidase 1
14	9606.ENSP00000245222	0.955	Sphingosine kinase 2
15	9606.ENSP00000311648	0.955	2-hydroxyacylsphingosine 1-beta-galactosyltransferase
16	9606.ENSP00000378176	0.955	Phosphatidylcholine:ceramide cholinephosphotransferase 2
17	9606.ENSP00000216264	0.952	Ceramide kinase
18	9606.ENSP00000378897	0.948	Neutral ceramidase
19	9606.ENSP00000247225	0.945	Sphingosine-1-phosphate phosphatase 1
20	9606.ENSP00000261304	0.944	Galactocerebrosidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016717	0.999	oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
GO:0042284	0.856	sphingolipid delta-4 desaturase activity
GO:0005488	0.793	binding
GO:0005515	0.771	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.997	lipid metabolic process
GO:1901576	0.996	organic substance biosynthetic process
GO:0044249	0.996	cellular biosynthetic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:0008610	0.990	lipid biosynthetic process
GO:0006665	0.990	sphingolipid metabolic process
GO:1901566	0.979	organonitrogen compound biosynthetic process
GO:0030148	0.974	sphingolipid biosynthetic process
GO:0044281	0.419	small molecule metabolic process
GO:0043603	0.308	amide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.999	endoplasmic reticulum
GO:0031090	0.997	organelle membrane
GO:0031984	0.996	organelle subcompartment
GO:0005789	0.976	endoplasmic reticulum membrane
GO:0005739	0.542	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.14.19.-	0.999	With oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water.
RHEA:46544	0.856	an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O
EC:1.14.19.17	0.856	sphingolipid 4-desaturase.

[back to server]