StarFunc result for job id Q6QHK4

User Input

>input (219 residues)
MDPAPGVLDPRAAPPALLGTPQAEVLEDVLREQFGPLPQLAAVCRLKRLPSGGYSSTENL
QLVLERRRVANAKERERIKNLNRGFARLKALVPFLPQSRKPSKVDILKGATEYIQVLSDL
LEGAKDSKKQDPDEQSYSNNSSESHTSSARQLSRNITQHISCAFGLKNEEEGPWADGGSG
EPAHACRHSVMSTTEIISPTRSLDRFPEVELLSHRLPQV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6QHK4	1.000	1.000	2.059E-36	219	1.000	1.000	Q6QHK4.pdb.gz	FIGLA_HUMAN Factor in the germline alpha OS=Homo sapiens OX=9606 GN=FIGLA PE=1 SV=2
2	AFDB:O55208	0.513	0.576	4.677E-21	194	0.589	0.665	O55208.pdb.gz	FIGLA_MOUSE Factor in the germline alpha OS=Mus musculus OX=10090 GN=Figla PE=2 SV=1
3	AFDB:Q568W8	0.379	0.377	7.668E-9	220	0.269	0.268	Q568W8.pdb.gz	Q568W8_DANRE FIGalpha OS=Danio rerio OX=7955 GN=FIGalpha PE=2 SV=1
4	AFDB:B0R059	0.303	0.231	1.706E-5	292	0.247	0.185	B0R059.pdb.gz	B0R059_DANRE Atonal bHLH transcription factor 1a OS=Danio rerio OX=7955 GN=Atoh1.1 PE=4 SV=1
5	AFDB:P09774	0.257	0.222	1.945E-4	257	0.224	0.191	P09774.pdb.gz	AST3_DROME Achaete-scute complex protein T3 OS=Drosophila melanogaster OX=7227 GN=l(1)sc PE=2 SV=2
6	AFDB:Q92858	0.292	0.186	2.081E-4	354	0.224	0.138	Q92858.pdb.gz	ATOH1_HUMAN Transcription factor ATOH1 OS=Homo sapiens OX=9606 GN=ATOH1 PE=2 SV=1
7	AFDB:Q6PFG8	0.318	0.258	2.383E-4	273	0.228	0.183	Q6PFG8.pdb.gz	OLIG3_MOUSE Oligodendrocyte transcription factor 3 OS=Mus musculus OX=10090 GN=Olig3 PE=2 SV=1
8	AFDB:P48985	0.292	0.188	2.549E-4	351	0.247	0.154	P48985.pdb.gz	ATOH1_MOUSE Transcription factor Atoh1 OS=Mus musculus OX=10090 GN=Atoh1 PE=1 SV=1
9	AFDB:P50538	0.273	0.264	2.728E-4	227	0.178	0.172	P50538.pdb.gz	MAD1_MOUSE Max dimerization protein 1 OS=Mus musculus OX=10090 GN=Mxd1 PE=1 SV=2
10	AFDB:B3DH94	0.314	0.332	2.919E-4	206	0.233	0.248	B3DH94.pdb.gz	B3DH94_DANRE Atonal bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=Atoh1.2 PE=2 SV=1
11	PDB:7odr0	0.110	0.205	5.791E-1	110	0.059	0.118	7odr0.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
12	PDB:3j6bW	0.110	0.168	6.630E-1	112	0.078	0.152	3j6bW.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
13	PDB:3ojaA	0.193	0.104	1.492	482	0.050	0.023	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
14	PDB:6lssR	0.164	0.223	1.828	150	0.073	0.107	6lssR.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
15	PDB:7payA	0.160	0.114	2.563	329	0.064	0.043	7payA.pdb.gz	Structural basis for long-chain isoprenoid synthesis by cis -prenyltransferases.
16	PDB:7z37DP1	0.154	0.129	2.563	273	0.082	0.066	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
17	PDB:5khrN	0.107	0.042	4.114	645	0.068	0.023	5khrN.pdb.gz
18	PDB:6j6gA	0.095	0.020	4.114	1913	0.087	0.010	6j6gA.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
19	PDB:2bskD	0.161	0.354	4.402	90	0.041	0.100	2bskD.pdb.gz
20	PDB:4v8mAG	0.115	0.172	4.710	141	0.119	0.184	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6QHK4	1.36e-161	446	219	1.000	1.000	FIGLA_HUMAN Factor in the germline alpha OS=Homo sapiens OX=9606 GN=FIGLA PE=1 SV=2
2	O55208	2.39e-85	253	194	0.589	0.665	FIGLA_MOUSE Factor in the germline alpha OS=Mus musculus OX=10090 GN=Figla PE=2 SV=1
3	Q568W8	8.04e-23	94.0	220	0.233	0.232	Q568W8_DANRE FIGalpha OS=Danio rerio OX=7955 GN=FIGalpha PE=2 SV=1
4	B3DH94	3.60e-10	59.7	206	0.132	0.141	B3DH94_DANRE Atonal bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=Atoh1.2 PE=2 SV=1
5	A0A2R8QBT6	1.53e-09	57.0	160	0.155	0.212	A0A2R8QBT6_DANRE Musculin OS=Danio rerio OX=7955 GN=msc PE=4 SV=1
6	O57598	2.26e-09	56.2	151	0.132	0.192	ATOH7_CHICK Transcription factor ATOH7 OS=Gallus gallus OX=9031 GN=ATOH7 PE=1 SV=2
7	Q60756	2.90e-09	57.0	195	0.160	0.179	TCF15_MOUSE Transcription factor 15 OS=Mus musculus OX=10090 GN=Tcf15 PE=1 SV=2
8	Q9VL05	5.11e-09	55.8	174	0.137	0.172	Q9VL05_DROME FI14601p OS=Drosophila melanogaster OX=7227 GN=Hand PE=2 SV=3
9	B0R059	9.09e-09	56.6	292	0.160	0.120	B0R059_DANRE Atonal bHLH transcription factor 1a OS=Danio rerio OX=7955 GN=Atoh1.1 PE=4 SV=1
10	Q8AW52	1.12e-08	53.9	134	0.123	0.201	ATOH7_DANRE Transcription factor atoh7 OS=Danio rerio OX=7955 GN=atoh7 PE=1 SV=1
11	O13125	1.54e-08	53.9	138	0.151	0.239	ATO7A_XENLA Transcription factor Atoh7-a OS=Xenopus laevis OX=8355 GN=atoh7-a PE=1 SV=1
12	P48987	3.88e-08	54.7	312	0.123	0.087	ATO_DROME Protein atonal OS=Drosophila melanogaster OX=7227 GN=ato PE=1 SV=2
13	P61295	5.06e-08	53.5	217	0.132	0.134	HAND2_RAT Heart- and neural crest derivatives-expressed protein 2 OS=Rattus norvegicus OX=10116 GN=Hand2 PE=2 SV=1
14	P61296	5.06e-08	53.5	217	0.132	0.134	HAND2_HUMAN Heart- and neural crest derivatives-expressed protein 2 OS=Homo sapiens OX=9606 GN=HAND2 PE=1 SV=1
15	Q61039	5.06e-08	53.5	217	0.132	0.134	HAND2_MOUSE Heart- and neural crest derivatives-expressed protein 2 OS=Mus musculus OX=10090 GN=Hand2 PE=1 SV=3
16	Q6VNZ9	5.50e-08	53.9	239	0.151	0.138	MYF6_DANRE Myogenic factor 6 OS=Danio rerio OX=7955 GN=myf6 PE=2 SV=1
17	P13903	6.69e-08	52.8	166	0.155	0.205	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
18	P57102	9.15e-08	52.8	208	0.114	0.120	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
19	Q90690	9.71e-08	52.8	216	0.119	0.120	HAND2_CHICK Heart- and neural crest derivatives-expressed protein 2 OS=Gallus gallus OX=9031 GN=HAND2 PE=2 SV=1
20	Q20561	1.79e-07	51.2	147	0.105	0.156	HLH13_CAEEL Helix-loop-helix protein 13 OS=Caenorhabditis elegans OX=6239 GN=hlh-13 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00010 HLH	6.4e-13	59.8	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333097

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419457	0.895	Homeobox protein NOBOX
2	9606.ENSP00000252677	0.836	Bone morphogenetic protein 15
3	9606.ENSP00000367942	0.826	Growth/differentiation factor 9
4	9606.ENSP00000378326	0.823	Zona pellucida sperm-binding protein 3
5	9606.ENSP00000294638	0.816	LIM/homeobox protein Lhx8
6	9606.ENSP00000404438	0.773	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 1
7	9606.ENSP00000262753	0.767	Protein POF1B
8	9606.ENSP00000007699	0.765	Y-box-binding protein 2
9	9606.ENSP00000460971	0.755	Zona pellucida sperm-binding protein 2
10	9606.ENSP00000359454	0.751	Probable ATP-dependent DNA helicase HFM1
11	9606.ENSP00000250863	0.725	Deleted in azoospermia-like
12	9606.ENSP00000333188	0.722	Forkhead box protein L2
13	9606.ENSP00000369210	0.717	Spermatogenesis- and oogenesis-specific basic helix-loop-helix-containing protein 2
14	9606.ENSP00000319799	0.702	Histone H1oo
15	9606.ENSP00000359392	0.693	KHDC3-like protein
16	9606.ENSP00000296096	0.672	Transcription factor 23
17	9606.ENSP00000329803	0.659	Zygote arrest protein 1
18	9606.ENSP00000221496	0.631	Muellerian-inhibiting factor
19	9606.ENSP00000384708	0.629	Follicle-stimulating hormone receptor
20	9606.ENSP00000371711	0.625	Doublesex- and mab-3-related transcription factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0043425	0.995	bHLH transcription factor binding
GO:0070888	0.994	E-box binding
GO:0140110	0.822	transcription regulator activity
GO:0003700	0.768	DNA-binding transcription factor activity
GO:0000981	0.303	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.995	regulation of primary metabolic process
GO:0031323	0.995	regulation of cellular metabolic process
GO:0010468	0.995	regulation of gene expression
GO:0006355	0.991	regulation of DNA-templated transcription
GO:0048518	0.968	positive regulation of biological process
GO:0006357	0.949	regulation of transcription by RNA polymerase II
GO:0048522	0.941	positive regulation of cellular process
GO:0045944	0.876	positive regulation of transcription by RNA polymerase II
GO:0009987	0.824	cellular process
GO:0032501	0.682	multicellular organismal process
GO:0032502	0.662	developmental process
GO:0048856	0.556	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0032991	0.994	protein-containing complex
GO:0043231	0.973	intracellular membrane-bounded organelle
GO:0005634	0.964	nucleus
GO:0005667	0.784	transcription regulator complex
GO:0005737	0.691	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]