StarFunc result for job id Q6QN14

User Input

>input (398 residues)
MEDDSLYLRGEWQFNHFSKLTSSRPDAAFAEIQRTSLPEKSPLSCETRVDLCDDLAPVAR
QLAPREKLPLSSRRPAAVGAGLQNMGNTCYVNASLQCLTYTPPLANYMLSREHSQTCHRH
KGCMLCTMQAHITRALHNPGHVIQPSQALAAGFHRGKQEDAHEFLMFTVDAMKKACLPGH
KQVDHHSKDTTLIHQIFGGYWRSQIKCLHCHGISDTFDPYLDIALDIQAAQSVQQALEQL
VKPEELNGENAYHCGVCLQRAPASKTLTLHTSAKVLILVLKRFSDVTGNKIAKNVQYPEC
LDMQPYMSQQNTGPLVYVLYAVLVHAGWSCHNGHYFSYVKAQEGQWYKMDDAEVTASSIT
SVLSQQAYVLFYIQKSEWERHSESVSRGREPRALGSED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0WX57	0.872	0.657	8.822E-79	530	0.995	0.747	Q0WX57.pdb.gz	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	AFDB:Q9H9J4	0.776	0.240	9.792E-52	1324	0.560	0.168	Q9H9J4.pdb.gz	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
3	AFDB:B2RQC2	0.777	0.240	7.409E-51	1324	0.543	0.163	B2RQC2.pdb.gz	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
4	AFDB:G5E8G2	0.780	0.579	9.434E-50	545	0.513	0.374	G5E8G2.pdb.gz	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
5	AFDB:E7F4C0	0.778	0.287	5.664E-49	1104	0.457	0.165	E7F4C0.pdb.gz	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
6	AFDB:A0A024R8V6	0.773	0.280	1.800E-48	1123	0.475	0.168	A0A024R8V6.pdb.gz
7	AFDB:B1AQJ2	0.774	0.287	2.021E-48	1098	0.455	0.165	B1AQJ2.pdb.gz	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
8	AFDB:Q7M764	0.765	0.570	5.098E-48	540	0.505	0.372	Q7M764.pdb.gz	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
9	AFDB:E9Q9U0	0.769	0.658	5.401E-48	468	0.495	0.421	E9Q9U0.pdb.gz	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
10	AFDB:Q61068	0.782	0.600	1.092E-46	526	0.495	0.375	Q61068.pdb.gz	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
11	PDB:3mhsA	0.661	0.583	2.839E-29	455	0.239	0.209	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:5cvnB	0.655	0.804	9.213E-27	321	0.206	0.255	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:4fjcE	0.600	0.553	1.317E-25	434	0.229	0.210	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
14	PDB:8a9kD	0.589	0.807	2.487E-25	285	0.183	0.256	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
15	PDB:4wa6D	0.592	0.569	1.119E-24	415	0.219	0.210	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
16	PDB:5k16B	0.618	0.737	3.167E-24	328	0.216	0.262	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
17	PDB:7yxxA	0.643	0.155	7.540E-24	1754	0.244	0.055	7yxxA.pdb.gz
18	PDB:7ay1D	0.627	0.724	2.015E-23	341	0.196	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
19	PDB:7w3ax	0.607	0.496	8.640E-22	494	0.198	0.160	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
20	PDB:5gjqx	0.613	0.682	1.089E-21	355	0.198	0.223	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q0WX57	0.0	836	530	0.995	0.747	U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens OX=9606 GN=USP17L24 PE=1 SV=2
2	Q6QN14	0.0	837	398	1.000	1.000	U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens OX=9606 GN=USP17L6P PE=1 SV=2
3	Q6R6M4	0.0	797	530	0.955	0.717	U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens OX=9606 GN=USP17L2 PE=1 SV=2
4	Q9H9J4	3.01e-144	444	1324	0.533	0.160	UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42 PE=1 SV=3
5	B2RQC2	6.44e-143	441	1324	0.530	0.159	UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus OX=10090 GN=Usp42 PE=1 SV=1
6	G5E8G2	2.59e-140	412	545	0.510	0.372	U17PD_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein D OS=Mus musculus OX=10090 GN=Usp17ld PE=1 SV=1
7	G5E8I7	2.59e-140	412	545	0.510	0.372	U17LC_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein C OS=Mus musculus OX=10090 GN=Usp17lc PE=1 SV=1
8	E9Q9U0	1.17e-139	408	468	0.495	0.421	U17PB_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein B OS=Mus musculus OX=10090 GN=Usp17lb PE=1 SV=1
9	Q7M764	4.54e-138	407	540	0.510	0.376	U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus OX=10090 GN=Usp17le PE=3 SV=2
10	Q61068	3.44e-132	391	526	0.495	0.375	U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus OX=10090 GN=Usp17la PE=1 SV=1
11	E9PEW0	6.63e-131	389	548	0.452	0.328	E9PEW0_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=2
12	E7F4C0	2.21e-124	387	1104	0.465	0.168	E7F4C0_DANRE Ubiquitin carboxyl-terminal hydrolase 36 OS=Danio rerio OX=7955 GN=usp37 PE=4 SV=2
13	Q9P275	2.77e-124	387	1123	0.450	0.159	UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4
14	B1AQJ2	3.62e-122	381	1098	0.450	0.163	UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus OX=10090 GN=Usp36 PE=1 SV=1
15	O74442	4.51e-83	263	457	0.362	0.315	UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp16 PE=1 SV=1
16	F4I642	4.62e-71	241	928	0.304	0.130	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
17	Q9FPS9	5.16e-71	241	924	0.304	0.131	UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=2
18	Q9SB51	1.42e-60	213	1008	0.279	0.110	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
19	Q9VRP5	1.26e-53	193	1038	0.294	0.113	UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster OX=7227 GN=scny PE=1 SV=3
20	Q9FIQ1	5.85e-51	184	732	0.276	0.150	UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana OX=3702 GN=UBP21 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00443 UCH	9e-49	178.0	Ubiquitin carboxyl-terminal hydrolase
2	PF13423 UCH_1	5.4e-13	60.9	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427366

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000422097	0.771	Ubiquitin specific peptidase 17-like family member 25
2	9606.ENSP00000425375	0.771	Ubiquitin specific peptidase 17-like family member 24
3	9606.ENSP00000309163	0.670	CAAX prenyl protease 2
4	9606.ENSP00000443988	0.663	Sin3 histone deacetylase corepressor complex component SDS3
5	9606.ENSP00000263966	0.532	Ubiquitin carboxyl-terminal hydrolase 13
6	9606.ENSP00000285420	0.510	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
7	9606.ENSP00000156084	0.509	OTU domain-containing protein 5
8	9606.ENSP00000229268	0.509	Ubiquitin carboxyl-terminal hydrolase 5
9	9606.ENSP00000448841	0.502	Nuclear pore complex interacting protein family member A3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0005515	0.986	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019538	0.995	protein metabolic process
GO:0016579	0.991	protein deubiquitination
GO:0009987	0.953	cellular process
GO:0044237	0.769	cellular metabolic process
GO:0030163	0.756	protein catabolic process
GO:0050794	0.577	regulation of cellular process
GO:0044260	0.576	cellular macromolecule metabolic process
GO:0051603	0.575	proteolysis involved in protein catabolic process
GO:0044265	0.492	cellular macromolecule catabolic process
GO:0006511	0.477	ubiquitin-dependent protein catabolic process
GO:0048518	0.348	positive regulation of biological process
GO:0048522	0.336	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.999	cytoplasm
GO:0031981	0.885	nuclear lumen
GO:0005829	0.698	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]