StarFunc result for job id Q6QNY1

User Input

>input (142 residues)
MAAAAEGVLATRSDEPARDDAAVETAEEAKEPAEADITELCRDMFSKMATYLTGELTATS
EDYKLLENMNKLTSLKYLEMKDIAINISRNLKDLNQKYAGLQPYLDQINVIEEQVAALEQ
AAYKLDAYSKKLEAKYKKLEKR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9CWG9	0.870	0.865	1.821E-17	143	0.951	0.944	Q9CWG9.pdb.gz	BL1S2_MOUSE Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Mus musculus OX=10090 GN=Bloc1s2 PE=1 SV=1
2	AFDB:A2BIA5	0.827	0.667	6.590E-14	177	0.746	0.599	A2BIA5.pdb.gz	A2BIA5_DANRE Biogenesis of lysosomal organelles complex-1, subunit 2 OS=Danio rerio OX=7955 GN=zgc:111974 PE=3 SV=1
3	AFDB:Q95XD3	0.725	0.779	4.653E-4	132	0.296	0.318	Q95XD3.pdb.gz	BL1S2_CAEEL Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Caenorhabditis elegans OX=6239 GN=blos-2 PE=1 SV=1
4	AFDB:Q9ULD5	0.439	0.093	7.359E-1	831	0.113	0.019	Q9ULD5.pdb.gz	ZN777_HUMAN Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=3
5	AFDB:Q6ZS10	0.247	0.105	1.209	378	0.155	0.058	Q6ZS10.pdb.gz	CL17A_HUMAN C-type lectin domain family 17, member A OS=Homo sapiens OX=9606 GN=CLEC17A PE=1 SV=2
6	AFDB:C5J7W5	0.268	0.065	1.550	1011	0.134	0.019	C5J7W5.pdb.gz
7	AFDB:Q2HXU8	0.438	0.250	1.550	276	0.106	0.054	Q2HXU8.pdb.gz	CL12B_HUMAN C-type lectin domain family 12 member B OS=Homo sapiens OX=9606 GN=CLEC12B PE=1 SV=1
8	AFDB:Q9UN81	0.321	0.148	1.550	338	0.211	0.089	Q9UN81.pdb.gz	LORF1_HUMAN LINE-1 retrotransposable element ORF1 protein OS=Homo sapiens OX=9606 GN=L1RE1 PE=1 SV=1
9	AFDB:B1AV60	0.472	0.044	1.829	1647	0.127	0.011	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
10	AFDB:Q8NC01	0.468	0.247	1.829	280	0.127	0.064	Q8NC01.pdb.gz	CLC1A_HUMAN C-type lectin domain family 1 member A OS=Homo sapiens OX=9606 GN=CLEC1A PE=1 SV=2
11	PDB:5wlcST	0.334	0.094	4.278	599	0.148	0.035	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:7d4iRJ	0.326	0.078	6.471	738	0.099	0.019	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
13	PDB:6xt9J	0.140	0.324	7.635	55	0.042	0.109	6xt9J.pdb.gz
14	PDB:7abgv	0.284	0.336	7.635	119	0.085	0.101	7abgv.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:7ajuCL	0.308	0.058	7.635	808	0.070	0.012	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:5aj0AD	0.208	0.115	8.294	294	0.035	0.017	5aj0AD.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:8ap7N	0.186	0.190	8.294	139	0.063	0.065	8ap7N.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
18	PDB:7kzmD	0.150	0.060	9.787	456	0.049	0.015	7kzmD.pdb.gz	Structure of a microtubule-bound axonemal dynein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6QNY1	1.87e-98	280	142	1.000	1.000	BL1S2_HUMAN Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2 PE=1 SV=1
2	Q32WR5	4.68e-94	270	142	0.965	0.965	BL1S2_RAT Biogenesis of lysosome-related organelles complex-1 subunit 2 OS=Rattus norvegicus OX=10116 GN=Bloc1s2 PE=2 SV=1
3	Q9CWG9	4.52e-80	234	143	0.951	0.944	BL1S2_MOUSE Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Mus musculus OX=10090 GN=Bloc1s2 PE=1 SV=1
4	E9QEJ0	1.09e-72	216	174	0.754	0.615	E9QEJ0_DANRE Biogenesis of lysosomal organelles complex-1, subunit 2 OS=Danio rerio OX=7955 GN=zgc:111974 PE=3 SV=1
5	A2BIA5	3.12e-72	216	177	0.754	0.605	A2BIA5_DANRE Biogenesis of lysosomal organelles complex-1, subunit 2 OS=Danio rerio OX=7955 GN=zgc:111974 PE=3 SV=1
6	Q9VTE0	2.03e-21	86.3	159	0.345	0.308	BL1S2_DROME Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Drosophila melanogaster OX=7227 GN=Blos2 PE=1 SV=2
7	Q95XD3	1.03e-18	78.6	132	0.275	0.295	BL1S2_CAEEL Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Caenorhabditis elegans OX=6239 GN=blos-2 PE=1 SV=1
8	F4K657	4.99e-10	55.8	127	0.211	0.236	BL1S2_ARATH Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Arabidopsis thaliana OX=3702 GN=BLOS2 PE=1 SV=1
9	Q39119	0.75	32.0	494	0.218	0.063	VPEG_ARATH Vacuolar-processing enzyme gamma-isozyme OS=Arabidopsis thaliana OX=3702 GN=At4g32940 PE=1 SV=2
10	P95223	0.99	31.6	1209	0.127	0.015	P95223_MYCTU Probable 5-oxoprolinase OplA (5-oxo-L-prolinase) (Pyroglutamase) (5-OPASE) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=oplA PE=1 SV=2
11	Q8BWP8	3.2	30.0	415	0.204	0.070	B4GA1_MOUSE Beta-1,4-glucuronyltransferase 1 OS=Mus musculus OX=10090 GN=B4gat1 PE=1 SV=1
12	Q6R2K1	3.4	30.0	699	0.155	0.031	SRF5_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 5 OS=Arabidopsis thaliana OX=3702 GN=SRF5 PE=1 SV=1
13	B0R197	4.4	29.3	318	0.106	0.047	B0R197_DANRE Voltage-dependent anion channel 3 OS=Danio rerio OX=7955 GN=wu:fb01e12 PE=1 SV=1
14	P43671	5.2	29.3	546	0.141	0.037	PQIB_ECOLI Intermembrane transport protein PqiB OS=Escherichia coli (strain K12) OX=83333 GN=pqiB PE=1 SV=2
15	Q5AL49	5.2	29.3	751	0.176	0.033	SEC2_CANAL Rab guanine nucleotide exchange factor SEC2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SEC2 PE=1 SV=2
16	F1MAA7	6.8	29.3	1607	0.197	0.017	F1MAA7_RAT Laminin subunit gamma 1 OS=Rattus norvegicus OX=10116 GN=Lamc1 PE=1 SV=1
17	E9Q8Q6	7.1	28.9	1531	0.127	0.012	CC141_MOUSE Coiled-coil domain-containing protein 141 OS=Mus musculus OX=10090 GN=Ccdc141 PE=1 SV=2
18	Q1LVF0	7.2	28.9	1593	0.254	0.023	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
19	A0A0H3LF05	7.5	28.5	217	0.169	0.111	A0A0H3LF05_MYCTE Two component transcriptional regulatoryprotein OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) OX=652616 GN=devR PE=4 SV=1
20	P9WMF9	7.5	28.5	217	0.169	0.111	DEVR_MYCTU DNA-binding transcriptional activator DevR/DosR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=devR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	2e-32	122.8	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF08702 Fib_alpha	6.1e+02	12.0	Fibrinogen alpha/beta chain family
3	PF19191 HEF_HK	8.8e+02	11.8	HEF_HK domain
4	PF08775 ParB	2.8e+02	13.4	ParB family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357674	0.999	SNARE-associated protein Snapin
2	9606.ENSP00000447650	0.999	Uncharacterized protein
3	9606.ENSP00000447537	0.998	Biogenesis of lysosome-related organelles complex 1 subunit 1
4	9606.ENSP00000341680	0.997	Dysbindin
5	9606.ENSP00000393840	0.997	Biogenesis of lysosome-related organelles complex 1 subunit 3
6	9606.ENSP00000220531	0.994	Biogenesis of lysosome-related organelles complex 1 subunit 6
7	9606.ENSP00000472836	0.990	KxDL motif-containing protein 1
8	9606.ENSP00000425864	0.976	BLOC-1-related complex subunit 8
9	9606.ENSP00000380598	0.972	Biogenesis of lysosome-related organelles complex 1 subunit 5
10	9606.ENSP00000318128	0.969	Biogenesis of lysosome-related organelles complex 1 subunit 4
11	9606.ENSP00000373669	0.968	BLOC-1-related complex subunit 6
12	9606.ENSP00000321546	0.961	BLOC-1-related complex subunit 5
13	9606.ENSP00000342331	0.955	BLOC-1-related complex subunit 7
14	9606.ENSP00000371308	0.923	Centromere protein J
15	9606.ENSP00000265967	0.919	Hermansky-Pudlak syndrome 5 protein
16	9606.ENSP00000281871	0.913	Mitotic spindle organizing protein 2B
17	9606.ENSP00000248846	0.905	Gamma-tubulin complex component 6
18	9606.ENSP00000260383	0.903	Gamma-tubulin complex component 4
19	9606.ENSP00000418960	0.903	Breast cancer type 1 susceptibility protein
20	9606.ENSP00000367049	0.900	Mitotic-spindle organizing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0009987	0.975	cellular process
GO:0048518	0.973	positive regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0051179	0.968	localization
GO:0051641	0.948	cellular localization
GO:0048522	0.948	positive regulation of cellular process
GO:0051640	0.947	organelle localization
GO:1990849	0.898	vacuolar localization
GO:0019222	0.889	regulation of metabolic process
GO:0006810	0.879	transport
GO:0009893	0.876	positive regulation of metabolic process
GO:0051649	0.866	establishment of localization in cell
GO:0046907	0.861	intracellular transport
GO:0071840	0.832	cellular component organization or biogenesis
GO:0016043	0.801	cellular component organization
GO:0031323	0.787	regulation of cellular metabolic process
GO:0060255	0.782	regulation of macromolecule metabolic process
GO:0051171	0.782	regulation of nitrogen compound metabolic process
GO:0045944	0.766	positive regulation of transcription by RNA polymerase II
GO:0065008	0.737	regulation of biological quality
GO:0006996	0.719	organelle organization
GO:0090559	0.690	regulation of membrane permeability
GO:0007154	0.608	cell communication
GO:0051656	0.547	establishment of organelle localization
GO:0006839	0.522	mitochondrial transport
GO:0007005	0.516	mitochondrion organization
GO:0050896	0.451	response to stimulus
GO:0023052	0.385	signaling
GO:0007017	0.329	microtubule-based process
GO:0032418	0.313	lysosome localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0012505	0.995	endomembrane system
GO:0005813	0.991	centrosome
GO:0005829	0.989	cytosol
GO:0005634	0.986	nucleus
GO:0031082	0.985	BLOC complex
GO:0031982	0.951	vesicle
GO:0097708	0.935	intracellular vesicle
GO:0031410	0.924	cytoplasmic vesicle
GO:0031083	0.901	BLOC-1 complex
GO:0016020	0.886	membrane
GO:0070013	0.577	intracellular organelle lumen
GO:0031981	0.519	nuclear lumen
GO:0005654	0.401	nucleoplasm
GO:0005768	0.390	endosome
GO:0000930	0.334	gamma-tubulin complex
GO:0005739	0.322	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]