StarFunc result for job id Q6R2W3

User Input

>input (1325 residues)
MEAVSRVFPALAGQAPEEQGEIIKVKVKEEDHTWDQESALRRNLSYTRELSRQRFRQFCY
QETPGPREALSQLRELCRQWLNPEIHTKEQILELLVLEQFLTILPEELQSWVREHNPESG
EEVVTLLEDLERELDEPRQQVSQGTYGQEVSMEEMIPLDSAKESLGTQLQSMEDRMECES
PEPHPLQDNGSFLWFSMMSQSMGGDNLSSLDTNEAEIEPENMREKFFRSLARLLENKSNN
TKIFSKAKYCQLIKEVKEAKAKAKKESVDYRRLARFDVILVQGNEKLIEAVNGETDKIRY
YLHSEDLFDILHNTHLSIGHGGRTRMEKELQAKYKNITKEVIMLYLTLCKPCQQKNSKLK
KVLTSKSIKEVSSRCQVDLIDMQLNPDGEYRFILHYQDLCTKLTFLRSLKSKRPTEVAHA
LLDIFTIIGAPSVLQSDNGREFSSQVVSELSNIWPELKIVHGKSQTCQSQSSAEQTEDIR
KRIFSWMQTNNSSHWTEFLWFIQMSQNQPYHRSMQQTPCESAFSSEAKLGLSHSQLTEEL
VASLHTENELDQADKELENTLRAQYEENIETGTDSSDIEENLSVTPKVAEKSPPESRLRF
LSCVVCEKECTGVNSCISCDGNIHAICGVPSQHGTEGCGRQITCSLCYETSTMKRKHDEI
QRSLPVKPSKMLKPSGTPFSPDKVGDWMAKQASLDFFVKKRHAFSEHSSSNKRNVNNRSY
PEEGKTKRVHASFTRKYDPSYIEFGFVAVIDGEVLKPQCIICGDVLANEAMKPSKLKRHL
YSKHKEISSQPKEFFERKSSELKSQPKQVFNVSHINISALRASYKVALPVAKSKTPYTIA
ETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFS
LQLDECRDIANMIILLVYVRFEHDDDIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGL
EFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLN
DIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLV
FLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKL
EAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPR
IGNLWIQNPFLSSKDNLNLTVTLQDKLLKLATDEGLKISFENTASLPSFWIKAKNDYPEL
AEIALKLLLLFPSTYLCETGFSTLSVIKTKHRNSLNIHYPLRVALSSIQPRLDKLTSKKQ
AHLSH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6R2W3	1.000	1.000	0.000	1325	1.000	1.000	Q6R2W3.pdb.gz	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
2	AFDB:O95789	0.390	0.390	1.941E-54	1325	0.205	0.205	O95789.pdb.gz	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
3	AFDB:B2RPU8	0.415	0.709	8.408E-49	756	0.183	0.320	B2RPU8.pdb.gz	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
4	AFDB:Q8TCP9	0.383	0.862	4.356E-41	573	0.163	0.377	Q8TCP9.pdb.gz	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
5	AFDB:Q6ZNG9	0.157	0.405	1.449E-33	492	0.170	0.457	Q6ZNG9.pdb.gz	KRBA2_HUMAN KRAB-A domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KRBA2 PE=1 SV=1
6	AFDB:Q7L775	0.322	0.656	2.482E-25	607	0.099	0.216	Q7L775.pdb.gz	EPMIP_HUMAN EPM2A-interacting protein 1 OS=Homo sapiens OX=9606 GN=EPM2AIP1 PE=1 SV=1
7	AFDB:Q9Y5A6	0.071	0.192	3.749E-9	473	0.097	0.271	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
8	AFDB:Q8NF99	0.076	0.181	5.343E-9	534	0.080	0.199	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
9	AFDB:Q3ZBY5	0.073	0.201	8.321E-9	466	0.080	0.227	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
10	AFDB:O43309	0.077	0.167	1.690E-8	604	0.084	0.184	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
11	PDB:7q5bB	0.130	0.292	1.026E-5	482	0.043	0.118	7q5bB.pdb.gz	Structural basis of Ty3 retrotransposon integration at RNA Polymerase III-transcribed genes.
12	PDB:3idhA	0.081	0.175	1.751E-2	453	0.029	0.086	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
13	PDB:4ehtA	0.072	0.193	1.534E-1	268	0.018	0.090	4ehtA.pdb.gz	On the ATP-Dependent Activation of the Radical Enzyme (R)-2-Hydroxyisocaproyl-CoA Dehydratase.
14	PDB:8dqwE	0.048	0.117	2.001E-1	354	0.026	0.096	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
15	PDB:6m5rA	0.057	0.102	2.187E-1	646	0.010	0.020	6m5rA.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
16	PDB:2j68A	0.048	0.074	2.729E-1	680	0.050	0.097	2j68A.pdb.gz	A Bacterial Dynamin-Like Protein
17	PDB:6m5uA	0.060	0.112	2.853E-1	585	0.018	0.041	6m5uA.pdb.gz	Architecture of the herpesvirus genome-packaging complex and implications for DNA translocation.
18	PDB:7r5jK0	0.064	0.073	3.890E-1	1086	0.039	0.048	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:6oonA	0.049	0.071	4.250E-1	785	0.009	0.015	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
20	PDB:7p5jA	0.038	0.095	4.854E-1	399	0.035	0.115	7p5jA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6R2W3	0.0	2749	1325	1.000	1.000	SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCAND3 PE=1 SV=1
2	O95789	3.37e-153	499	1325	0.192	0.192	ZMYM6_HUMAN Zinc finger MYM-type protein 6 OS=Homo sapiens OX=9606 GN=ZMYM6 PE=1 SV=2
3	Q6ZNG9	5.52e-136	427	492	0.171	0.459	KRBA2_HUMAN KRAB-A domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KRBA2 PE=1 SV=1
4	B2RPU8	9.77e-125	406	756	0.169	0.296	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
5	Q8TCP9	1.99e-107	353	573	0.155	0.358	F200A_HUMAN Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1
6	Q8IZ13	1.56e-95	321	594	0.147	0.328	F200C_HUMAN Protein FAM200C OS=Homo sapiens OX=9606 GN=FAM200C PE=1 SV=1
7	Q8CEW7	1.19e-92	313	583	0.122	0.276	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
8	O43309	1.66e-53	201	611	0.082	0.177	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
9	Q96LW9	1.38e-52	192	406	0.081	0.264	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
10	Q9H4T2	1.50e-52	190	348	0.072	0.276	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
11	Q3MJ62	6.79e-51	187	389	0.072	0.247	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
12	Q8NF99	2.15e-50	189	534	0.078	0.193	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
13	P49910	3.70e-50	187	485	0.076	0.208	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
14	Q53Z40	3.70e-50	187	485	0.076	0.208	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
15	O15535	4.27e-50	185	394	0.074	0.249	ZSC9_HUMAN Zinc finger and SCAN domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZSCAN9 PE=1 SV=1
16	P17028	1.35e-46	174	368	0.071	0.255	ZNF24_HUMAN Zinc finger protein 24 OS=Homo sapiens OX=9606 GN=ZNF24 PE=1 SV=4
17	Q3ZBY5	5.19e-46	175	466	0.072	0.204	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
18	Q91VN1	8.93e-46	171	368	0.069	0.250	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
19	Q9BRR0	5.58e-45	174	538	0.076	0.188	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
20	Q15776	7.08e-45	174	578	0.077	0.176	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05699 Dimer_Tnp_hAT	0.25	22.5	hAT family C-terminal dimerisation region
2	PF14291 DUF4371	0.0015	29.7	Domain of unknown function (DUF4371)
3	PF17921 Integrase_H2C2	1.9	19.9	Integrase zinc binding domain
4	PF00665 rve	15	17.2	Integrase core domain
5	PF02023 SCAN	7.7e-40	145.9	SCAN domain
6	PF16991 SIR4_SID	2.3e+02	13.2	Sir4 SID domain
7	PF02892 zf-BED	1e+02	14.4	BED zinc finger
8	PF18658 zf-C2H2_12	70	14.5	Spin-doc zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000395259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000338860	0.844	Zinc finger protein 444
2	9606.ENSP00000380057	0.828	Zinc finger and SCAN domain-containing protein 32
3	9606.ENSP00000302310	0.825	Zinc finger protein 396
4	9606.ENSP00000355053	0.707	Zinc finger and SCAN domain-containing protein 20
5	9606.ENSP00000366509	0.696	Zinc finger protein with KRAB and SCAN domains 4
6	9606.ENSP00000250076	0.660	Zinc finger protein 232
7	9606.ENSP00000453364	0.509	HLA complex group 27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.439	identical protein binding
GO:0003677	0.434	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.955	positive regulation of biological process
GO:0042127	0.933	regulation of cell population proliferation
GO:0048522	0.904	positive regulation of cellular process
GO:0051726	0.870	regulation of cell cycle
GO:0050678	0.870	regulation of epithelial cell proliferation
GO:0045787	0.858	positive regulation of cell cycle
GO:0050679	0.818	positive regulation of epithelial cell proliferation
GO:0009987	0.477	cellular process
GO:0071704	0.398	organic substance metabolic process
GO:0044238	0.387	primary metabolic process
GO:0006807	0.385	nitrogen compound metabolic process
GO:0043170	0.348	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005634	0.954	nucleus
GO:0031981	0.807	nuclear lumen
GO:0005654	0.698	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]