StarFunc result for job id Q6R327

User Input

>input (1708 residues)
MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGVSNMRKLGHL
NNFTKLLCDIGHSEEKLGFHYEDIIICLRLALLNEAKEVRAAGLRALRYLIQDSSILQKV
LKLKVDYLIARCIDIQQSNEVERTQALRLVRKMITVNASLFPSSVTNSLIAVGNDGLQER
DRMVRACIAIICELALQNPEVVALRGGLNTILKNVIDCQLSRINEALITTILHLLNHPKT
RQYVRADVELERILAPYTDFHYRHSPDTAEGQLKEDREARFLASKMGIIATFRSWAGIIN
LCKPGNSGIQSLIGVLCIPNMEIRRGLLEVLYDIFRLPLPVVTEEFIEALLSVDPGRFQD
SWRLSDGFVAAEAKTILPHRARSRPDLMDNYLALILSAFIRNGLLEGLVEVITNSDDHIS
VRATILLGELLHMANTILPHSHSHHLHCLPTLMNMAASFDIPKEKRLRASAALNCLKRFH
EMKKRGPKPYSLHLDHIIQKAIATHQKRDQYLRVQKDIFILKDTEEALLINLRDSQVLQH
KENLEWNWNLIGTILKWPNVNLRNYKDEQLHRFVRRLLYFYKPSSKLYANLDLDFAKAKQ
LTVVGCQFTEFLLESEEDGQGYLEDLVKDIVQWLNASSGMKPERSLQNNGLLTTLSQHYF
LFIGTLSCHPHGVKMLEKCSVFQCLLNLCSLKNQDHLLKLTVSSLDYSRDGLARVILSKI
LTAATDACRLYATKHLRVLLRANVEFFNNWGIELLVTQLHDKNKTISSEALDILDEACED
KANLHALIQMKPALSHLGDKGLLLLLRFLSIPKGFSYLNERGYVAKQLEKWHREYNSKYV
DLIEEQLNEALTTYRKPVDGDNYVRRSNQRLQRPHVYLPIHLYGQLVHHKTGCHLLEVQN
IITELCRNVRTPDLDKWEEIKKLKASLWALGNIGSSNWGLNLLQEENVIPDILKLAKQCE
VLSIRGTCVYVLGLIAKTKQGCDILKCHNWDAVRHSRKHLWPVVPDDVEQLCNELSSIPS
TLSLNSESTSSRHNSESESVPSSMFILEDDRFGSSSTSTFFLDINEDTEPTFYDRSGPIK
DKNSFPFFASSKLVKNRILNSLTLPNKKHRSSSDPKGGKLSSESKTSNRRIRTLTEPSVD
FNHSDDFTPISTVQKTLQLETSFMGNKHIEDTGSTPSIGENDLKFTKNFGTENHRENTSR
ERLVVESSTSSHMKIRSQSFNTDTTTSGISSMSSSPSRETVGVDATTMDTDCGSMSTVVS
TKTIKTSHYLTPQSNHLSLSKSNSVSLVPPGSSHTLPRRAQSLKAPSIATIKSLADCNFS
YTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRF
MKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVK
DIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDA
SLFLESTEDTGLQEHTDDNCLYCVCIEILGFQPSNQLSAICSHSDFQDIPYSDWCEQTIH
NPLEVVPSKFSGISGCSDGVSQEGSASSTKSTELLLGVKTIPDDTPMCRILLRKEVLRLV
INLSSSVSTKCHETGLLTIKEKYPQTFDDICLYSEVSHLLSHCTFRLPCRRFIQELFQDV
QFLQMHEEAEAVLATPPKQPIVDTSAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6zwmE	0.631	0.958	0.000	1117	0.653	0.999	6zwmE.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
2	AFDB:Q6QI06	0.743	0.743	0.000	1708	0.954	0.954	Q6QI06.pdb.gz	RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus OX=10090 GN=Rictor PE=1 SV=2
3	AFDB:Q6PR54	0.110	0.083	2.743E-12	2419	0.128	0.090	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
4	AFDB:E1C2U2	0.152	0.118	5.379E-12	2326	0.128	0.094	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
5	AFDB:Q5UIP0	0.101	0.079	3.693E-10	2472	0.128	0.088	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
6	AFDB:F4IAT2	0.076	0.073	1.245E-8	1823	0.124	0.116	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
7	AFDB:O95996	0.114	0.093	2.837E-8	2303	0.109	0.081	O95996.pdb.gz	APCL_HUMAN Adenomatous polyposis coli protein 2 OS=Homo sapiens OX=9606 GN=APC2 PE=1 SV=1
8	PDB:3w3zA	0.155	0.224	9.640E-8	1013	0.083	0.139	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
9	PDB:6xu2A	0.121	0.160	7.552E-7	1091	0.081	0.127	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	PDB:7unkA	0.132	0.199	1.058E-6	1047	0.070	0.115	7unkA.pdb.gz
11	PDB:3w3uA	0.166	0.226	1.140E-6	1030	0.078	0.129	3w3uA.pdb.gz
12	AFDB:A0A0G2JZW4	0.086	0.068	1.391E-6	2308	0.103	0.076	A0A0G2JZW4.pdb.gz	A0A0G2JZW4_RAT APC regulator of WNT signaling pathway 2 OS=Rattus norvegicus OX=10116 GN=Apc2 PE=3 SV=2
13	PDB:3nd2A	0.170	0.260	2.236E-6	861	0.079	0.157	3nd2A.pdb.gz
14	PDB:1qgkA	0.186	0.292	2.905E-6	876	0.077	0.150	1qgkA.pdb.gz
15	PDB:7mqaSP	0.149	0.117	5.915E-6	2485	0.077	0.053	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
16	AFDB:Q9VW47	0.091	0.072	6.451E-6	2531	0.122	0.082	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
17	PDB:7wttK	0.129	0.192	6.618E-6	1022	0.067	0.112	7wttK.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
18	PDB:4a0cA	0.160	0.209	7.133E-6	1155	0.078	0.115	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
19	AFDB:X1WE68	0.081	0.063	1.873E-4	2527	0.103	0.070	X1WE68.pdb.gz
20	AFDB:E9PD50	0.055	0.071	3.046E-4	1170	0.098	0.143	E9PD50.pdb.gz	E9PD50_HUMAN Nonsense-mediated mRNA decay factor OS=Homo sapiens OX=9606 GN=SMG7 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZNG4	0.0	3414	1733	0.967	0.953	A0A8I5ZNG4_RAT RPTOR independent companion of MTOR, complex 2 OS=Rattus norvegicus OX=10116 GN=Rictor PE=1 SV=1
2	A0A8I5ZQ26	0.0	3123	1557	0.880	0.965	A0A8I5ZQ26_RAT RPTOR independent companion of MTOR, complex 2 OS=Rattus norvegicus OX=10116 GN=Rictor PE=1 SV=1
3	F1M4J0	0.0	3321	1656	0.937	0.967	F1M4J0_RAT RPTOR independent companion of MTOR, complex 2 OS=Rattus norvegicus OX=10116 GN=Rictor PE=1 SV=4
4	Q6QI06	0.0	3272	1708	0.954	0.954	RICTR_MOUSE Rapamycin-insensitive companion of mTOR OS=Mus musculus OX=10090 GN=Rictor PE=1 SV=2
5	Q6R327	0.0	3530	1708	1.000	1.000	RICTR_HUMAN Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1
6	X2JL73	3.13e-155	524	1916	0.207	0.185	X2JL73_DROME Rapamycin-insensitive companion of Tor, isoform B OS=Drosophila melanogaster OX=7227 GN=rictor PE=1 SV=1
7	O77203	2.71e-132	444	1148	0.180	0.267	PIAA_DICDI Protein pianissimo A OS=Dictyostelium discoideum OX=44689 GN=piaA PE=1 SV=1
8	Q09743	2.22e-98	350	1309	0.153	0.200	RICTR_SCHPO Target of rapamycin complex 2 subunit ste20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ste20 PE=1 SV=1
9	Q7YU91	1.37e-75	281	1936	0.106	0.093	Q7YU91_DROME SD16537p OS=Drosophila melanogaster OX=7227 GN=rictor PE=2 SV=1
10	Q9VWJ6	1.37e-75	281	1936	0.106	0.093	Q9VWJ6_DROME FI03615p OS=Drosophila melanogaster OX=7227 GN=rictor PE=1 SV=2
11	X2JFR5	8.46e-75	279	1924	0.103	0.091	X2JFR5_DROME Rapamycin-insensitive companion of Tor, isoform C OS=Drosophila melanogaster OX=7227 GN=rictor PE=1 SV=1
12	P40061	4.14e-61	234	1430	0.138	0.165	TSC11_YEAST Target of rapamycin complex 2 subunit TSC11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSC11 PE=1 SV=1
13	A0A1D8PTJ4	6.61e-61	233	1287	0.155	0.206	A0A1D8PTJ4_CANAL TORC2 complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TSC11 PE=3 SV=1
14	G5EFK2	2.24e-34	147	1578	0.056	0.061	G5EFK2_CAEEL RICTOR_N domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rict-1 PE=1 SV=1
15	Q57YZ3	2.77e-15	84.7	1405	0.121	0.147	Q57YZ3_TRYB2 Rapamycin-insensitive companion of TOR2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.28L1.170 PE=1 SV=1
16	Q9ET01	1.5	36.2	850	0.008	0.016	PYGL_MOUSE Glycogen phosphorylase, liver form OS=Mus musculus OX=10090 GN=Pygl PE=1 SV=4
17	P06737	1.9	35.8	847	0.008	0.017	PYGL_HUMAN Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4
18	Q585M4	2.0	35.4	427	0.015	0.059	Q585M4_TRYB2 Eukaryotic translation initiation factor 4E, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.28P18.1010 PE=3 SV=1
19	Q9VXG8	3.5	35.0	2517	0.014	0.010	ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster OX=7227 GN=mei-41 PE=1 SV=2
20	P0DMS1	4.3	34.7	947	0.015	0.027	NET2A_ARATH Protein NETWORKED 2A OS=Arabidopsis thaliana OX=3702 GN=NET2A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10316 7TM_GPCR_Srbc	3.1e+02	12.2	Serpentine type 7TM GPCR chemoreceptor Srbc
2	PF14663 RasGEF_N_2	2.3e-32	123.0	Rapamycin-insensitive companion of mTOR RasGEF_N domain
3	PF14666 RICTOR_M	9.8e-30	113.7	Rapamycin-insensitive companion of mTOR, middle domain
4	PF14664 RICTOR_N	6e-104	359.7	Rapamycin-insensitive companion of mTOR, N-term
5	PF14665 RICTOR_phospho	8.5e-45	163.0	Rapamycin-insensitive companion of mTOR, phosphorylation-site
6	PF14668 RICTOR_V	9.4e-29	110.8	Rapamycin-insensitive companion of mTOR, domain 5

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265960	0.999	Target of rapamycin complex 2 subunit MAPKAP1
2	9606.ENSP00000286234	0.999	DEP domain-containing mTOR-interacting protein
3	9606.ENSP00000307272	0.999	Regulatory-associated protein of mTOR
4	9606.ENSP00000354558	0.999	Serine/threonine-protein kinase mTOR
5	9606.ENSP00000379975	0.999	Integrin-linked protein kinase
6	9606.ENSP00000384848	0.999	Proline-rich protein 5
7	9606.ENSP00000456405	0.999	Target of rapamycin complex subunit LST8
8	9606.ENSP00000451828	0.998	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000219476	0.997	Tuberin
10	9606.ENSP00000368144	0.996	Proline-rich protein 5-like
11	9606.ENSP00000356832	0.992	Serine/threonine-protein kinase Sgk1
12	9606.ENSP00000225577	0.990	Ribosomal protein S6 kinase beta-1
13	9606.ENSP00000326804	0.985	Cullin-1
14	9606.ENSP00000362547	0.985	TELO2-interacting protein 1 homolog
15	9606.ENSP00000298552	0.984	Hamartin
16	9606.ENSP00000375892	0.981	RAC-beta serine/threonine-protein kinase
17	9606.ENSP00000263826	0.977	RAC-gamma serine/threonine-protein kinase
18	9606.ENSP00000408695	0.975	Protein kinase C alpha type
19	9606.ENSP00000262319	0.956	Telomere length regulation protein TEL2 homolog
20	9606.ENSP00000375711	0.941	Proline-rich AKT1 substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.980	enzyme binding
GO:0044877	0.927	protein-containing complex binding
GO:0043022	0.899	ribosome binding
GO:0019901	0.887	protein kinase binding
GO:0060090	0.820	molecular adaptor activity
GO:0098772	0.507	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0031323	0.992	regulation of cellular metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0048522	0.984	positive regulation of cellular process
GO:0048583	0.977	regulation of response to stimulus
GO:0042127	0.977	regulation of cell population proliferation
GO:0051897	0.968	positive regulation of protein kinase B signaling
GO:0051174	0.957	regulation of phosphorus metabolic process
GO:0001936	0.956	regulation of endothelial cell proliferation
GO:0008284	0.940	positive regulation of cell population proliferation
GO:0042325	0.939	regulation of phosphorylation
GO:0050679	0.905	positive regulation of epithelial cell proliferation
GO:0001938	0.904	positive regulation of endothelial cell proliferation
GO:0009987	0.879	cellular process
GO:0060255	0.713	regulation of macromolecule metabolic process
GO:0008152	0.679	metabolic process
GO:0044237	0.602	cellular metabolic process
GO:0080090	0.597	regulation of primary metabolic process
GO:0051171	0.588	regulation of nitrogen compound metabolic process
GO:0071704	0.580	organic substance metabolic process
GO:0051128	0.569	regulation of cellular component organization
GO:0044238	0.562	primary metabolic process
GO:0071840	0.539	cellular component organization or biogenesis
GO:0016043	0.506	cellular component organization
GO:0009893	0.480	positive regulation of metabolic process
GO:0050896	0.429	response to stimulus
GO:0006807	0.423	nitrogen compound metabolic process
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0043170	0.363	macromolecule metabolic process
GO:0051246	0.358	regulation of protein metabolic process
GO:1901564	0.355	organonitrogen compound metabolic process
GO:0010604	0.349	positive regulation of macromolecule metabolic process
GO:0051716	0.348	cellular response to stimulus
GO:0019538	0.344	protein metabolic process
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0007154	0.312	cell communication
GO:0065009	0.311	regulation of molecular function
GO:0031399	0.309	regulation of protein modification process
GO:0010468	0.303	regulation of gene expression
GO:0036211	0.302	protein modification process
GO:0006796	0.301	phosphate-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031932	0.999	TORC2 complex
GO:0005829	0.994	cytosol
GO:0043227	0.610	membrane-bounded organelle
GO:0070013	0.580	intracellular organelle lumen
GO:0016020	0.501	membrane
GO:0043231	0.472	intracellular membrane-bounded organelle
GO:0005634	0.455	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]