StarFunc result for job id Q6RI45

User Input

>input (1802 residues)
MAAAPTQIEAELYYLIARFLQSGPCNKSAQVLVQELEEHQLIPRRLDWEGKEHRRSFEDL
VAANAHIPPDYLLKICERIGPLLDKEIPQSVPGVQTLLGVGRQSLLRDAKDCKSTLWNGS
AFAALHRGRPPELPVNYVKPPNVVNITSARQLTGCSRFGHIFPSSAYQHIKMHKRILGHL
SSVYCVAFDRSGRRIFTGSDDCLVKIWATDDGRLLATLRGHSAEISDMAVNYENTLIAAG
SCDKVVRVWCLRTCAPVAVLQGHSASITSIQFCPSTKGTNRYLTSTGADGTICFWQWHVK
TMKFRDRPVKFTERSRPGVQISCSSFSSGGMFITTGSTDHVIRIYYLGSEVPEKIAELES
HTDKVVAVQFCNNGDSLRFVSGSRDGTARIWQYQQQEWKSIVLDMATKMTGNNLPSGEDK
ITKLKVTMVAWDRYDTTVITAVNNFLLKVWNSITGQLLHTLSGHDDEVFVLEAHPFDQRI
ILSAGHDGNIFIWDLDRGTKIRNYFNMIEGQGHGAVFDCKFSPDGNHFACTDSHGHLLLF
GFGCSKYYEKIPDQMFFHTDYRPLIRDANNYVLDEQTQQAPHLMPPPFLVDVDGNPHPTK
FQRLVPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQDESILDGIIRELQREQDL
RLINEGDVPHLPVNRAYSVNGALRSPNMDISSSPNIRLRRHSSQIEGVRQMHNNAPRSQM
ATERDLMAWSRRVVVNELNNGVSRVQEECRTAKGDIEISLYTVEKKKKPSYTTQRNDYEP
SCGRSLRRTQRKRQHTYQTRSNIEHNSQASCQNSGVQEDSDSSSEEDETVGTSDASVEDP
VVEWQSESSSSDSSSEYSDWTADAGINLQPPKRQTRQTTRKICSSSDEENLKSLEERQKK
PKQTRKKKGGLVSIAGEPNEEWFAPQWILDTIPRRSPFVPQMGDELIYFRQGHEAYVRAV
RKSKIYSVNLQKQPWNKMDLREQEFVKIVGIKYEVGPPTLCCLKLAFLDPISGKMTGESF
SIKYHDMPDVIDFLVLHQFYNEAKERNWQIGDRFRSIIDDAWWFGTVESQQPFQPEYPDS
SFQCYSVHWDNNEREKMSPWDMEPIPEGTAFPDEVGAGVPVSQEELTALLYKPQEGEWGA
HSRDEECERVIQGINHLLSLDFASPFAVPVDLSAYPLYCTVVAYPTDLNTIRRRLENRFY
RRISALMWEVRYIEHNARTFNEPDSPIVKAAKIVTDVLLRFIGDQSCTDILDTYNKIKAE
ERNSTDAEEDTEIVDLDSDGPGTSSGRKVKCRGRRQSLKCNPDAWKKQCKELLSLIYERE
DSEPFRQPADLLSYPGHQEQEGESSESVVPERQQDSSLSEDYQDVIDTPVDFSTVKETLE
AGNYGSPLEFYKDVRQIFNNSKAYTSNKKSRIYSMMLRLSALFESHIKNIISEYKSAIQS
QKRRRPRYRKRLRSSSSSLSSSGAPSPKGKQKQMKLQPKNDQNTSVSHARTSSPFSSPVS
DAAEGLSLYLLDDEPDGPFSSSSFGGYSRSGNSHDPGKAKSFRNRVLPVKQDHSLDGPLT
NGDGREPRTGIKRKLLSASEEDENMGGEDKEKKETKEKSHLSTSESGELGSSLSSESTCG
SDSDSESTSRTDQDYVDGDHDYSKFIQTRPKRKLRKQHGNGKRNWKTRGTGGRGRWGRWG
RWSRGGRGRGGRGRGSRGRGGGGTRGRGRGRGGRGASRGATRAKRARIADDEFDTMFSGR
FSRLPRIKTRNQGRRTVLYNDDSDNDNFVSTEDPLNLGTSRSGRVRKMTEKARVSHLMGW
NY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6RI45	1.000	1.000	0.000	1802	1.000	1.000	Q6RI45.pdb.gz	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	AFDB:Q8VDD9	0.364	0.360	0.000	1821	0.554	0.548	Q8VDD9.pdb.gz	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
3	AFDB:Q921C3	0.343	0.273	0.000	2304	0.537	0.420	Q921C3.pdb.gz	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
4	AFDB:Q9NSI6	0.309	0.244	0.000	2320	0.541	0.420	Q9NSI6.pdb.gz	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
5	AFDB:Q9VC96	0.313	0.260	0.000	2232	0.373	0.301	Q9VC96.pdb.gz	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
6	PDB:5mzhB	0.189	0.773	7.970E-23	415	0.054	0.236	5mzhB.pdb.gz
7	PDB:7bt6x	0.180	0.640	2.025E-21	488	0.048	0.176	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
8	PDB:5nnzA	0.177	0.901	1.261E-20	335	0.046	0.248	5nnzA.pdb.gz
9	PDB:5jcsq	0.179	0.635	4.447E-19	488	0.047	0.174	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
10	PDB:2h9lA	0.148	0.706	1.029E-17	321	0.046	0.255	2h9lA.pdb.gz
11	PDB:7mqaLQ	0.094	0.182	1.984E-17	830	0.044	0.095	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:4v7fq	0.176	0.676	3.649E-17	443	0.044	0.181	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
13	PDB:7mq8LR	0.093	0.190	5.831E-17	773	0.043	0.101	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:3sfzA	0.147	0.226	2.614E-16	1133	0.053	0.084	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
15	AFDB:M9PB01	0.160	0.123	2.928E-16	2397	0.102	0.077	M9PB01.pdb.gz	M9PB01_DROME WD repeat domain 62, isoform G OS=Drosophila melanogaster OX=7227 GN=Wdr62 PE=4 SV=1
16	PDB:1vyhC	0.147	0.752	4.589E-16	310	0.039	0.226	1vyhC.pdb.gz
17	AFDB:Q389F7	0.144	0.227	5.587E-14	1105	0.095	0.155	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
18	AFDB:P07834	0.175	0.381	3.319E-13	779	0.047	0.108	P07834.pdb.gz	CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC4 PE=1 SV=2
19	AFDB:Q57VP9	0.094	0.068	7.213E-9	2653	0.129	0.087	Q57VP9.pdb.gz	Q57VP9_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.100 PE=4 SV=1
20	AFDB:Q80U93	0.143	0.125	6.234E-8	2085	0.115	0.100	Q80U93.pdb.gz	NU214_MOUSE Nuclear pore complex protein Nup214 OS=Mus musculus OX=10090 GN=Nup214 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6RI45	0.0	3754	1802	1.000	1.000	BRWD3_HUMAN Bromodomain and WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=BRWD3 PE=1 SV=2
2	Q8VDD9	0.0	1862	1821	0.519	0.513	PHIP_MOUSE PH-interacting protein OS=Mus musculus OX=10090 GN=Phip PE=1 SV=2
3	Q8WWQ0	0.0	1158	1821	0.314	0.310	PHIP_HUMAN PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2
4	Q921C3	0.0	1840	2304	0.509	0.398	BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus OX=10090 GN=Brwd1 PE=1 SV=2
5	Q9NSI6	0.0	1878	2320	0.521	0.405	BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1 PE=1 SV=4
6	Q9VC96	0.0	677	2232	0.173	0.139	Q9VC96_DROME BRWD3 OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=1 SV=2
7	Q8SX63	1.70e-156	527	1765	0.148	0.151	Q8SX63_DROME LD40380p OS=Drosophila melanogaster OX=7227 GN=BRWD3 PE=2 SV=1
8	Q57W14	2.41e-29	125	419	0.057	0.246	Q57W14_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.320 PE=4 SV=1
9	Q9VZF4	2.29e-28	127	1326	0.056	0.076	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
10	Q8N136	3.19e-26	115	415	0.052	0.224	DAW1_HUMAN Dynein assembly factor with WD repeat domains 1 OS=Homo sapiens OX=9606 GN=DAW1 PE=1 SV=1
11	Q3Y8L7	1.66e-25	114	446	0.053	0.213	DAW1_CHLRE Dynein assembly factor with WD repeat domains 1 OS=Chlamydomonas reinhardtii OX=3055 GN=DAW1 PE=1 SV=1
12	Q9D4T2	3.24e-25	110	304	0.050	0.296	Q9D4T2_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
13	Q1LV15	9.49e-24	108	415	0.051	0.222	DAW1_DANRE Dynein assembly factor with WD repeat domains 1 OS=Danio rerio OX=7955 GN=daw1 PE=1 SV=2
14	D3Z7A5	5.90e-23	105	415	0.050	0.217	DAW1_MOUSE Dynein assembly factor with WD repeat domains 1 OS=Mus musculus OX=10090 GN=Daw1 PE=2 SV=1
15	Q969H0	7.58e-23	108	707	0.050	0.127	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
16	Q8VBV4	8.48e-23	108	710	0.047	0.120	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
17	B7ZDC8	1.11e-21	103	544	0.050	0.165	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
18	Q57X86	4.65e-21	102	698	0.043	0.112	Q57X86_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.470 PE=4 SV=1
19	Q54KL5	1.43e-20	97.4	335	0.047	0.254	WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum OX=44689 GN=wdr5 PE=3 SV=1
20	Q9FN19	2.22e-20	100	613	0.057	0.168	HOS15_ARATH WD40 repeat-containing protein HOS15 OS=Arabidopsis thaliana OX=3702 GN=HOS15 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	7.8	18.2	Anaphase-promoting complex subunit 4 WD40 domain
2	PF06507 Auxin_resp	1.2e+02	14.4	Auxin response factor
3	PF00439 Bromodomain	4.3e-29	111.8	Bromodomain
4	PF20426 NBCH_WD40	0.00054	30.5	Neurobeachin beta propeller domain
5	PF00400 WD40	8.6e-32	119.9	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362372

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000260283	0.950	Rho GTPase-activating protein 20
2	9606.ENSP00000384109	0.847	Cullin-4B
3	9606.ENSP00000331556	0.740	Cylicin-1
4	9606.ENSP00000296328	0.734	UBX domain-containing protein 7
5	9606.ENSP00000265970	0.728	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha
6	9606.ENSP00000307208	0.728	Nucleosome-remodeling factor subunit BPTF
7	9606.ENSP00000261716	0.701	Serine/threonine-protein kinase TAO1
8	9606.ENSP00000301764	0.676	DNA damage-binding protein 1
9	9606.ENSP00000321348	0.676	Protein diaphanous homolog 2
10	9606.ENSP00000332756	0.639	Phospholipid-transporting ATPase IG
11	9606.ENSP00000328059	0.617	E3 ubiquitin-protein ligase RLIM
12	9606.ENSP00000262752	0.603	Ribosomal protein S6 kinase alpha-6
13	9606.ENSP00000362268	0.597	MICOS complex subunit MIC27
14	9606.ENSP00000362260	0.595	Zinc finger protein 711
15	9606.ENSP00000276201	0.593	Regulator of nonsense transcripts 3B
16	9606.ENSP00000406549	0.589	Transcription initiation factor TFIID subunit 1
17	9606.ENSP00000362441	0.580	Transcriptional regulator ATRX
18	9606.ENSP00000349689	0.577	Palmitoyltransferase ZDHHC9
19	9606.ENSP00000363985	0.565	Myotubularin-related protein 8
20	9606.ENSP00000418379	0.565	Transcription initiation factor TFIID subunit 1-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.988	cellular process
GO:0071840	0.885	cellular component organization or biogenesis
GO:0016043	0.873	cellular component organization
GO:0050794	0.845	regulation of cellular process
GO:0022604	0.809	regulation of cell morphogenesis
GO:0006996	0.633	organelle organization
GO:0019222	0.601	regulation of metabolic process
GO:0008360	0.601	regulation of cell shape
GO:0060255	0.543	regulation of macromolecule metabolic process
GO:0007010	0.518	cytoskeleton organization
GO:0051171	0.475	regulation of nitrogen compound metabolic process
GO:0080090	0.473	regulation of primary metabolic process
GO:0031323	0.456	regulation of cellular metabolic process
GO:0010468	0.452	regulation of gene expression
GO:0031326	0.430	regulation of cellular biosynthetic process
GO:0048518	0.428	positive regulation of biological process
GO:0010556	0.410	regulation of macromolecule biosynthetic process
GO:0019219	0.397	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.315	regulation of DNA-templated transcription
GO:0048522	0.314	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.793	cytoplasm
GO:0043232	0.760	intracellular non-membrane-bounded organelle
GO:0005829	0.385	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]