StarFunc result for job id Q6S8J3

User Input

>input (1075 residues)
MVVEVDSMPAASSVKKPFGLRSKMGKWCCRCFPCYRESGKSNVGTSGDHDDSAMKTLRSK
MGKWCHHCFPCCRGSGKSNVGASGDHDDSAMKTLRNKMGKWCCHCFPCCRGSGKSKVGAW
GDYDDSAFMEPRYHVRGEDLDKLHRAAWWGKVPRKDLIVMLRDTDVNKKDKQKRTALHLA
SANGNSEVVKLLLDRRCQLNVLDNKKRTALIKAVQCQEDECALMLLEHGTDPNIPDEYGN
TTLHYAIYNEDKLMAKALLLYGADIESKNKHGLTPLLLGVHEQKQQVVKFLIKKKANLNA
LDRYGRTALILAVCCGSASIVSLLLEQNIDVSSQDLSGQTAREYAVSSHHHVICQLLSDY
KEKQMLKISSENSNPEQELKLTSEEESQRFKGSENSQPEKMSQELEINKDGDREVEEEMK
KHESNNVGLLENLTNGVTAGNGDNGLIPQRKSRTPENQQFPDNESEEYHRICELLSDYKE
KQMPKYSSENSNPEQDLKLTSEEESQRLKGSENGQPEKRSQEPEINKDGDRELENFMAIE
EMKKHGSTHVGFPENLTNGATAGNGDDGLIPPRKSRTPESQQFPDTENEEYHSDEQNDTQ
KQFCEEQNTGILHDEILIHEEKQIEVVEKMNSELSLSCKKEKDVLHENSTLREEIAMLRL
ELDTMKHQSQLREKKYLEDIESVKKKNDNLLKALQLNELTMDDDTAVLVIDNGSGMCKAG
FAGDDAPRAVFPSIVGRPRQQGMMGGMHQKESYVGKEAQSKRGILTLKYPMEHGIITNWD
DMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVP
SLYTSGRTTGIVMDSGDGVTHTVPIYEGNALPHATLRLDLAGRELPDYLMKILTERGYRF
TTMAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEA
LFQPCFLGMESCGIHETTFNSIMKSDVDIRKDLYTNTVLSGGTTMYPGMAHRMQKEIAAL
APSMMKIRIIAPPKRKYSVWVGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5A3E0	0.381	0.381	0.000	1075	0.986	0.986	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
2	AFDB:P07829	0.347	0.991	2.969E-63	376	0.299	0.854	P07829.pdb.gz	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
3	AFDB:B6VNT8	0.348	0.989	2.118E-62	377	0.305	0.870	B6VNT8.pdb.gz	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
4	AFDB:Q562R1	0.347	0.988	1.311E-60	376	0.297	0.848	Q562R1.pdb.gz	ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2
5	AFDB:P10989	0.347	0.993	1.377E-60	375	0.295	0.845	P10989.pdb.gz	ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=act1 PE=1 SV=1
6	AFDB:P0CJ46	0.346	0.984	2.040E-60	377	0.288	0.822	P0CJ46.pdb.gz	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
7	AFDB:A0A1D8PFR4	0.347	0.988	4.504E-59	376	0.282	0.806	A0A1D8PFR4.pdb.gz	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
8	AFDB:A0JP26	0.266	0.483	8.120E-59	581	0.469	0.867	A0JP26.pdb.gz	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
9	AFDB:P86287	0.347	0.988	1.145E-58	376	0.268	0.766	P86287.pdb.gz	ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) OX=137071 GN=ACT1 PE=1 SV=1
10	PDB:1c0gA	0.338	0.978	1.220E-58	368	0.299	0.872	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
11	AFDB:Q8RYC2	0.347	0.984	1.966E-58	378	0.260	0.741	Q8RYC2.pdb.gz	ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana OX=3702 GN=ACT5 PE=5 SV=1
12	PDB:1yagA	0.343	0.982	3.120E-57	372	0.288	0.833	1yagA.pdb.gz	The structure of nonvertebrate actin: Implications for the ATP hydrolytic mechanism
13	PDB:6tu4A	0.340	0.961	4.479E-54	372	0.268	0.774	6tu4A.pdb.gz	High-resolution structures of malaria parasite actomyosin and actin filaments.
14	PDB:4cbxA	0.330	0.982	1.000E-50	358	0.238	0.715	4cbxA.pdb.gz	Structural Differences Explain Diverse Functions of Plasmodium Actins.
15	PDB:4pl7A	0.319	0.893	7.539E-49	382	0.258	0.725	4pl7A.pdb.gz	Structural basis of thymosin-beta 4/profilin exchange leading to actin filament polymerization.
16	PDB:4a7fA	0.334	0.918	6.584E-47	375	0.303	0.869	4a7fA.pdb.gz	Structure of the Rigor Actin-Tropomyosin-Myosin Complex.
17	PDB:7nvmK	0.266	0.844	1.755E-38	317	0.270	0.915	7nvmK.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
18	PDB:6ltjK	0.291	0.971	1.381E-37	317	0.274	0.931	6ltjK.pdb.gz	Structure of nucleosome-bound human BAF complex.
19	PDB:5kg8B	0.284	0.946	3.364E-36	313	0.254	0.872	5kg8B.pdb.gz
20	PDB:6w18B	0.314	0.894	6.810E-33	367	0.159	0.466	6w18B.pdb.gz	Cryo-EM reveals the transition of Arp2/3 complex from inactive to nucleation-competent state.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PFR4	660	376	0.280	0.801	A0A1D8PFR4_CANAL Actin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ACT1 PE=3 SV=1
2	A0JP26	883	581	0.401	0.742	POTB3_HUMAN POTE ankyrin domain family member B3 OS=Homo sapiens OX=9606 GN=POTEB3 PE=1 SV=2
3	A5A3E0	2219	1075	0.986	0.986	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
4	B6VNT8	701	377	0.305	0.870	B6VNT8_PIG Actin alpha cardiac muscle 1 OS=Sus scrofa OX=9823 GN=ACTC1 PE=1 SV=1
5	F1P476	701	377	0.304	0.867	F1P476_CHICK Actin, alpha 2, smooth muscle, aorta OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
6	F1RCB6	689	377	0.298	0.849	F1RCB6_DANRE Actin alpha cardiac muscle 1a OS=Danio rerio OX=7955 GN=zgc:86725 PE=1 SV=1
7	G1NS52	728	376	0.317	0.907	G1NS52_MELGA Uncharacterized protein OS=Meleagris gallopavo OX=9103 GN=LOC100542800 PE=3 SV=1
8	G3CKA6	711	376	0.308	0.880	G3CKA6_SPOFR Actin OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
9	O45815	669	375	0.300	0.859	O45815_CAEEL Actin OS=Caenorhabditis elegans OX=6239 GN=act-5 PE=1 SV=1
10	P02572	722	376	0.313	0.894	ACT2_DROME Actin-42A OS=Drosophila melanogaster OX=7227 GN=Act42A PE=1 SV=3
11	P07828	637	380	0.273	0.771	ACT18_DICDI Actin-18 OS=Dictyostelium discoideum OX=44689 GN=act18 PE=3 SV=3
12	P07829	694	376	0.299	0.854	ACT3_DICDI Actin-3 OS=Dictyostelium discoideum OX=44689 GN=act3 PE=3 SV=3
13	P07830	702	376	0.305	0.872	ACT1_DICDI Major actin OS=Dictyostelium discoideum OX=44689 GN=act1 PE=1 SV=2
14	P08023	699	377	0.303	0.865	ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus OX=9031 GN=ACTA2 PE=3 SV=2
15	P0CG38	2175	1075	0.970	0.970	POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens OX=9606 GN=POTEI PE=3 SV=1
16	P0CG39	2082	1038	0.936	0.969	POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens OX=9606 GN=POTEJ PE=3 SV=1
17	P0CJ46	669	377	0.288	0.822	ACT1_ARATH Actin-1 OS=Arabidopsis thaliana OX=3702 GN=ACT1 PE=1 SV=1
18	P0CJ47	669	377	0.288	0.822	ACT3_ARATH Actin-3 OS=Arabidopsis thaliana OX=3702 GN=ACT3 PE=1 SV=1
19	P0DM41	721	376	0.312	0.891	ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans OX=6239 GN=act-1 PE=1 SV=1
20	P0DM42	721	376	0.312	0.891	ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans OX=6239 GN=act-3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00022 Actin	1.2e-137	470.3	Actin
2	PF00023 Ank	7.8e-22	87.9	Ankyrin repeat
3	PF12796 Ank_2	8.8e-31	117.6	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	3.5e-15	65.4	Ankyrin repeat
5	PF13637 Ank_4	2.6e-23	93.4	Ankyrin repeats (many copies)
6	PF13857 Ank_5	2.5e-24	96.3	Ankyrin repeats (many copies)
7	PF14915 CCDC144C	3.3e-10	51.2	CCDC144C protein coiled-coil region
8	PF18579 Raf1_HTH	4.1e+02	12.1	Rubisco accumulation factor 1 helix turn helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000439189

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348128	0.777	Supervillin
2	9606.ENSP00000296782	0.700	Rapamycin-insensitive companion of mTOR
3	9606.ENSP00000414906	0.610	Dynactin subunit 4
4	9606.ENSP00000318297	0.599	RuvB-like 1
5	9606.ENSP00000427687	0.595	WD repeat-containing protein 1
6	9606.ENSP00000336842	0.570	Actin-related protein 8
7	9606.ENSP00000417653	0.557	Drebrin-like protein
8	9606.ENSP00000457991	0.539	PH domain leucine-rich repeat-containing protein phosphatase 2
9	9606.ENSP00000355205	0.538	DNA helicase INO80
10	9606.ENSP00000301071	0.530	Tubulin alpha-1A chain
11	9606.ENSP00000352925	0.529	Transformation/transcription domain-associated protein
12	9606.ENSP00000401010	0.527	F-actin-capping protein subunit beta
13	9606.ENSP00000336831	0.521	Plastin-1
14	9606.ENSP00000473172	0.512	RuvB-like 2
15	9606.ENSP00000381581	0.510	Plastin-2
16	9606.ENSP00000229922	0.509	Adenylyl cyclase-associated protein 2
17	9606.ENSP00000361883	0.509	Adenylyl cyclase-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001895	0.992	retina homeostasis
GO:0009987	0.513	cellular process
GO:0065007	0.349	biological regulation
GO:0050789	0.338	regulation of biological process
GO:0050794	0.300	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070062	1.000	extracellular exosome
GO:0005622	0.820	intracellular anatomical structure
GO:0043229	0.783	intracellular organelle
GO:0043231	0.553	intracellular membrane-bounded organelle
GO:0005737	0.445	cytoplasm
GO:0072562	0.351	blood microparticle
GO:0043232	0.350	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]