StarFunc result for job id Q6SJ96

User Input

>input (375 residues)
MASAPWPERVPRLLAPRLPSYPPPPPTVGLRSMEQEETYLELYLDQCAAQDGLAPPRSPL
FSPVVPYDMYILNASNPDTAFNSNPEVKETSGDFSSVDLSFLPDEVTQENKDQPVISKHE
TEENSESQSPQSRLPSPSEQDVGLGLNSSSLSNSHSQLHPGDTDSVQPSPEKPNSDSLSL
ASITPMTPMTPISECCGIVPQLQNIVSTVNLACKLDLKKIALHAKNAEYNPKRFAAVIMR
IREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPARFLDFKIQNMVGSCD
VRFPIRLEGLVLTHQQFSSYEPELFPGLIYRMVKPRIVLLIFVSGKVVLTGAKERSEIYE
AFENIYPILKGFKKA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6SJ96	0.999	0.999	1.013E-61	375	1.000	1.000	Q6SJ96.pdb.gz	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
2	AFDB:Q6SJ95	0.623	0.665	5.784E-42	350	0.629	0.674	Q6SJ95.pdb.gz	TBPL2_MOUSE TATA box-binding protein-like 2 OS=Mus musculus OX=10090 GN=Tbpl2 PE=1 SV=1
3	AFDB:P53360	0.511	0.602	2.189E-36	318	0.533	0.629	P53360.pdb.gz	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
4	AFDB:P27633	0.521	0.657	5.115E-36	297	0.536	0.677	P27633.pdb.gz	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
5	AFDB:P20226	0.512	0.566	1.338E-35	339	0.485	0.537	P20226.pdb.gz	TBP_HUMAN TATA-box-binding protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=2
6	AFDB:P17871	0.484	0.783	9.120E-32	231	0.376	0.610	P17871.pdb.gz	TBP_SCHPO TATA-box-binding protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tbp1 PE=3 SV=1
7	AFDB:P13393	0.486	0.757	2.828E-31	240	0.387	0.604	P13393.pdb.gz	TBP_YEAST TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT15 PE=1 SV=3
8	AFDB:Q8W0W4	0.481	0.886	3.167E-31	203	0.389	0.719	Q8W0W4.pdb.gz	TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP2 PE=1 SV=2
9	PDB:5iy6P	0.487	0.978	5.043E-31	185	0.459	0.930	5iy6P.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
10	AFDB:O43133	0.484	0.760	5.269E-31	238	0.376	0.592	O43133.pdb.gz	TBP_CANAL TATA-box-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TBP1 PE=2 SV=1
11	AFDB:P26355	0.482	0.879	4.275E-30	205	0.376	0.688	P26355.pdb.gz	TBP_DICDI TATA-box-binding protein OS=Dictyostelium discoideum OX=44689 GN=tbpA PE=2 SV=2
12	PDB:1vokA	0.482	0.931	1.503E-29	192	0.387	0.755	1vokA.pdb.gz
13	PDB:7o4iO	0.475	0.980	7.756E-29	181	0.373	0.773	7o4iO.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
14	PDB:3ociB	0.467	0.966	2.312E-27	180	0.347	0.722	3ociB.pdb.gz
15	PDB:4pabB	0.240	0.133	4.562E-4	824	0.056	0.025	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
16	PDB:1wsvA	0.199	0.200	3.123E-3	371	0.048	0.049	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
17	PDB:1vloA	0.168	0.171	4.641E-3	364	0.037	0.038	1vloA.pdb.gz
18	PDB:2hzsD	0.094	0.132	7.723E-3	214	0.059	0.103	2hzsD.pdb.gz	Structure and TBP binding of the Mediator head subcomplex Med8-Med18-Med20.
19	PDB:2f1fA	0.140	0.231	8.648E-3	163	0.053	0.123	2f1fA.pdb.gz
20	PDB:2j0wA	0.153	0.136	1.439E-2	447	0.040	0.034	2j0wA.pdb.gz	Structures of R- and T-State Escherichia Coli Aspartokinase III: Mechanisms of the Allosteric Transition and Inhibition by Lysine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6SJ96	0.0	767	375	1.000	1.000	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
2	Q6SJ95	1.10e-157	448	350	0.640	0.686	TBPL2_MOUSE TATA box-binding protein-like 2 OS=Mus musculus OX=10090 GN=Tbpl2 PE=1 SV=1
3	Q5UE94	6.67e-151	430	320	0.645	0.756	TBPL2_XENLA TATA box-binding protein-like 2 OS=Xenopus laevis OX=8355 GN=tbpl2 PE=2 SV=1
4	Q28DH2	4.41e-143	410	322	0.627	0.730	TBPL2_XENTR TATA box-binding protein-like 2 OS=Xenopus tropicalis OX=8364 GN=tbpl2 PE=2 SV=1
5	Q32MN6	2.66e-128	372	288	0.544	0.708	Q32MN6_HUMAN TBP protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=1
6	Q7SXL3	4.68e-128	371	302	0.560	0.695	TBP_DANRE TATA-box-binding protein OS=Danio rerio OX=7955 GN=tbp PE=1 SV=1
7	Q66HB1	4.42e-127	370	318	0.488	0.575	Q66HB1_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=3 SV=1
8	P53360	4.82e-127	369	318	0.488	0.575	TBP_MESAU TATA-box-binding protein OS=Mesocricetus auratus OX=10036 GN=TBP PE=2 SV=1
9	P29037	4.85e-127	369	316	0.488	0.579	TBP_MOUSE TATA-box-binding protein OS=Mus musculus OX=10090 GN=Tbp PE=1 SV=1
10	Q28GG8	6.30e-127	368	297	0.488	0.616	TBP_XENTR TATA-box-binding protein OS=Xenopus tropicalis OX=8364 GN=tbp PE=2 SV=1
11	Q1JPY4	1.83e-126	368	312	0.563	0.676	TBPL2_DANRE TATA box-binding protein-like 2 OS=Danio rerio OX=7955 GN=tbpl2 PE=1 SV=1
12	P27633	2.84e-126	367	297	0.485	0.613	TBP_XENLA TATA-box-binding protein OS=Xenopus laevis OX=8355 GN=tbp PE=1 SV=1
13	P20226	4.04e-126	368	339	0.488	0.540	TBP_HUMAN TATA-box-binding protein OS=Homo sapiens OX=9606 GN=TBP PE=1 SV=2
14	P20227	1.75e-118	349	353	0.448	0.476	TBP_DROME TATA-box-binding protein OS=Drosophila melanogaster OX=7227 GN=Tbp PE=1 SV=1
15	A0A8I5Y1F6	1.11e-109	324	293	0.432	0.553	A0A8I5Y1F6_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
16	A0A8I6A9T0	6.03e-109	327	400	0.435	0.407	A0A8I6A9T0_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
17	A0A8I5ZNX4	1.34e-108	323	330	0.432	0.491	A0A8I5ZNX4_RAT TATA box binding protein OS=Rattus norvegicus OX=10116 GN=Tbp PE=1 SV=1
18	P32085	1.05e-107	321	340	0.408	0.450	TBP_CAEEL TATA-box-binding protein OS=Caenorhabditis elegans OX=6239 GN=tbp-1 PE=1 SV=1
19	Q8W0W4	1.80e-105	310	203	0.387	0.714	TBP2_ORYSJ TATA-binding protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TBP2 PE=1 SV=2
20	P13393	8.50e-105	310	240	0.376	0.588	TBP_YEAST TATA-box-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPT15 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11858 DUF3378	4.8	18.7	Domain of unknown function (DUF3378)
2	PF00352 TBP	4.9e-63	220.3	Transcription factor TFIID (or TATA-binding protein, TBP)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340271	0.998	Transcription initiation factor TFIID subunit 3
2	9606.ENSP00000359531	0.995	Transcription initiation factor IIB
3	9606.ENSP00000399982	0.970	Transcription initiation factor TFIID subunit 6
4	9606.ENSP00000379372	0.968	Transcription initiation factor IIA subunit 2
5	9606.ENSP00000252996	0.960	Transcription initiation factor TFIID subunit 4
6	9606.ENSP00000263974	0.959	Transcription initiation factor TFIID subunit 12
7	9606.ENSP00000312709	0.959	Transcription initiation factor TFIID subunit 7
8	9606.ENSP00000354633	0.955	Transcription initiation factor TFIID subunit 11
9	9606.ENSP00000367406	0.955	Transcription initiation factor TFIID subunit 2
10	9606.ENSP00000448323	0.955	Transcription factor IIIB 90 kDa subunit
11	9606.ENSP00000360515	0.948	Transcription initiation protein SPT3 homolog
12	9606.ENSP00000452454	0.948	Transcription initiation factor IIA subunit 1
13	9606.ENSP00000269142	0.947	Transcription initiation factor TFIID subunit 4B
14	9606.ENSP00000355051	0.946	Transcription initiation factor TFIID subunit 13
15	9606.ENSP00000418379	0.946	Transcription initiation factor TFIID subunit 1-like
16	9606.ENSP00000406549	0.945	Transcription initiation factor TFIID subunit 1
17	9606.ENSP00000339917	0.944	Transcription initiation factor TFIID subunit 9B
18	9606.ENSP00000351575	0.944	Transcription factor TFIIIB component B'' homolog
19	9606.ENSP00000358854	0.944	Transcription initiation factor TFIID subunit 5
20	9606.ENSP00000285398	0.927	TFIIH basal transcription factor complex helicase XPB subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003677	0.999	DNA binding
GO:0140223	0.852	general transcription initiation factor activity
GO:0016251	0.841	RNA polymerase II general transcription initiation factor activity
GO:0001067	0.835	transcription regulatory region nucleic acid binding
GO:1990837	0.834	sequence-specific double-stranded DNA binding
GO:0000976	0.816	transcription cis-regulatory region binding
GO:0000977	0.722	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001046	0.370	core promoter sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901360	0.995	organic cyclic compound metabolic process
GO:0046483	0.995	heterocycle metabolic process
GO:0006725	0.995	cellular aromatic compound metabolic process
GO:0034641	0.995	cellular nitrogen compound metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.990	macromolecule metabolic process
GO:0006351	0.965	DNA-templated transcription
GO:0032502	0.895	developmental process
GO:0006366	0.887	transcription by RNA polymerase II
GO:0032501	0.860	multicellular organismal process
GO:0065007	0.777	biological regulation
GO:0048856	0.646	anatomical structure development
GO:0050789	0.630	regulation of biological process
GO:0009790	0.598	embryo development
GO:0050794	0.582	regulation of cellular process
GO:0019222	0.495	regulation of metabolic process
GO:0060255	0.444	regulation of macromolecule metabolic process
GO:0051171	0.407	regulation of nitrogen compound metabolic process
GO:0031323	0.406	regulation of cellular metabolic process
GO:0080090	0.396	regulation of primary metabolic process
GO:0010468	0.390	regulation of gene expression
GO:0019219	0.378	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.339	regulation of cellular biosynthetic process
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0048518	0.325	positive regulation of biological process
GO:0006355	0.304	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.957	cytoplasm
GO:0032991	0.925	protein-containing complex
GO:0031981	0.842	nuclear lumen
GO:1902494	0.576	catalytic complex
GO:0005654	0.528	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]